Anti-Phospholipase A2 / PLA2G4A / CPLA2

Anti-Phospholipase A2 / PLA2G4A / CPLA2
Item number Size Datasheet Manual SDS Delivery time Quantity Price
NSJ-R32107 100 µg - -

7 - 12 business days*

790.00€
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Phospholipase A2, Group IVA, is an enzyme... more
Product information "Anti-Phospholipase A2 / PLA2G4A / CPLA2"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Phospholipase A2, Group IVA, is an enzyme that in humans is encoded by the PLA2G4A gene. Tay et al. (1995) mapped the PLA2G4A gene to rat chromosome 13 by PCR-based intercross genotyping and to human 1q25 by fluorescence in situ hybridization. By site-directed mutagenesis and biochemical analysis of the recombinant protein, Sharp et al. (1994) determined that ser228 participates in the catalytic mechanism of cPLA2 and that both the phospholipase A2 and the lysophospholipase activities are catalyzed by the same active site residue(s). PLA2G4A, the cytosolic phospholipase A2, appears to subserve transmembrane signaling responses to extracellular ligands (Skorecki, 1995). Protein function: Selectively hydrolyzes arachidonyl phospholipids in the sn-2 position releasing arachidonic acid. Together with its lysophospholipid activity, it is implicated in the initiation of the inflammatory response. [The UniProt Consortium]
Keywords: Anti-cPLA2, Anti-CPLA2, Anti-PLA2G4A, EC=3.1.1.5, EC=3.1.1.4, Anti-Phospholipase A2, Anti-Lysophospholipase, Anti-Cytosolic phospholipase A2, Anti-Phospholipase A2 group IVA, Anti-Phosphatidylcholine 2-acylhydrolase, Phospholipase A2 Antibody / PLA2G4A /
Supplier: NSJ Bioreagents
Supplier-Nr: R32107

Properties

Application: WB
Antibody Type: Polyclonal
Conjugate: No
Host: Rabbit
Species reactivity: human, mouse
Immunogen: Amino acids NFQYPNQAFKRLHDLMHFNTLNNIDVIKEAMVESIEYRRQ of human PLA2G4A were used as the immunogen for the Phospholipase A2 antibody.
Format: Purified

Handling & Safety

Storage: -20°C
Shipping: -20°C (International: -20°C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-Phospholipase A2 / PLA2G4A / CPLA2"
Write a review
or to review a product.
Viewed