Anti-PGRMC1 (Progesterone Receptor Membrane Component 1, HPR6.6, MPR)

Anti-PGRMC1 (Progesterone Receptor Membrane Component 1, HPR6.6, MPR)
Item number Size Datasheet Manual SDS Delivery time Quantity Price
250038.100 100 µg - -

3 - 19 business days*

850.00€
 
Progesterone binding protein is a putative steroid membrane receptor. The protein is expressed... more
Product information "Anti-PGRMC1 (Progesterone Receptor Membrane Component 1, HPR6.6, MPR)"
Progesterone binding protein is a putative steroid membrane receptor. The protein is expressed predominantly in the liver and kidney. [provided by RefSeq, Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: KVFDVTKGRKFYGPEGPYGVFAGRDASRGLATFCLDKEALKDEYDDLSDLTAAQQETLSDWESQFTFKYHHVGKLLKEGEEPTVYSDEEEPKDESARKND, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Supplier: United States Biological
Supplier-Nr: 250038

Properties

Application: ELISA, WB
Antibody Type: Monoclonal
Clone: 3F7
Conjugate: No
Host: Mouse
Species reactivity: human
Immunogen: PGRMC1 (NP_006658.1, 96aa-195aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Format: Purified

Database Information

Handling & Safety

Storage: -20°C
Shipping: +4°C (International: °C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-PGRMC1 (Progesterone Receptor Membrane Component 1, HPR6.6, MPR)"
Write a review
or to review a product.
Viewed