Anti-PGP9.5 / UchL1

Item number Size Datasheet Manual SDS Delivery time Quantity Price
NSJ-R31930 100 µg - -

3 - 10 business days*

790.00€
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. UchL1, also known as PGP9.5, is a member... more
Product information "Anti-PGP9.5 / UchL1"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. UchL1, also known as PGP9.5, is a member of a gene family whose products hydrolyze small C-terminal adducts of ubiquitin to generate the ubiquitin monomer. Expression of UchL1/PGP9.5 is highly specific to neurons and to cells of the diffuse neuroendocrine system and their tumors. It is abundantly present in all neurons (accounts for 1-2% of total brain protein), expressed specifically in neurons and testis/ovary. The catalytic triad of UchL1/PGP9.5 contains a cysteine at position 90, an aspartate at position 176, and a histidine at position 161 that are responsible for its hydrolase activity. Protein function: Ubiquitin-protein hydrolase involved both in the processing of ubiquitin precursors and of ubiquitinated proteins. This enzyme is a thiol protease that recognizes and hydrolyzes a peptide bond at the C-terminal glycine of ubiquitin. Also binds to free monoubiquitin and may prevent its degradation in lysosomes. The homodimer may have ATP-independent ubiquitin ligase activity. [The UniProt Consortium]
Keywords: Anti-UCHL1, Anti-UCH-L1, Anti-PGP9.5, Anti-PGP 9.5, EC=6.-.-.-, EC=3.4.19.12, Anti-Ubiquitin thioesterase L1, Anti-Neuron cytoplasmic protein 9.5, Anti-Ubiquitin carboxyl-terminal hydrolase isozyme L1, PGP9.5 / UchL1 Antibody
Supplier: NSJ Bioreagents
Supplier-Nr: R31930

Properties

Application: WB, IHC (paraffin)
Antibody Type: Polyclonal
Conjugate: No
Host: Rabbit
Species reactivity: human, mouse, rat
Immunogen: Amino acids ETEKMSPEDRAKCFEKNEAIQAAHDAVAQEGQCR of human PGP9.5 were used as the immunogen for the PGP 9.5 antibody.
Format: Purified

Handling & Safety

Storage: -20°C
Shipping: -20°C (International: -20°C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-PGP9.5 / UchL1"
Write a review
or to review a product.
Viewed