Anti-Peroxiredoxin 4

Item number	Size	Datasheet	Manual	SDS	Delivery time	Quantity	Price
ARG59034.50	50 µg		-	-	6 - 14 business days*		520.00€

If you have any questions, please use our Contact Form.
You can also order by e-mail: info@biomol.com
Larger quantity required? Request bulk

Protein function: Thiol-specific peroxidase that catalyzes the reduction of hydrogen peroxide and... more

Close menu

Product information "Anti-Peroxiredoxin 4"

Protein function: Thiol-specific peroxidase that catalyzes the reduction of hydrogen peroxide and organic hydroperoxides to water and alcohols, respectively. Plays a role in cell protection against oxidative stress by detoxifying peroxides and as sensor of hydrogen peroxide-mediated signaling events. Regulates the activation of NF-kappa-B in the cytosol by a modulation of I- kappa-B-alpha phosphorylation. [The UniProt Consortium]

Keywords:	Anti-PRDX4, Anti-Prx-IV, Anti-AOE37-2, Anti-Peroxiredoxin-4, Anti-Peroxiredoxin IV, Anti-Antioxidant enzyme AOE372, Anti-Thioredoxin peroxidase AO372, Anti-Thioredoxin-dependent peroxide reductase A0372
Supplier:	Arigo Biolaboratories
Supplier-Nr:	ARG59034

Properties

Application:	ICC, IHC (paraffin), WB
Antibody Type:	Polyclonal
Conjugate:	No
Host:	Rabbit
Species reactivity:	human, mouse, rat
Immunogen:	Synthetic peptide corresponding to aa. 178-208 of Human Peroxiredoxin 4 (SDLTHQISKDYGVYLEDSGHTLRGLFIIDDK)
MW:	31 kD
Format:	Antigen Affinity Purified