Anti-PEPD

Item number Size Datasheet Manual SDS Delivery time Quantity Price
ARG40851.50 50 µl - -

10 - 15 business days*

584.00€
 
Protein function: Splits dipeptides with a prolyl or hydroxyprolyl residue in the C-terminal... more
Product information "Anti-PEPD"
Protein function: Splits dipeptides with a prolyl or hydroxyprolyl residue in the C-terminal position. Plays an important role in collagen metabolism because the high level of iminoacids in collagen. [The UniProt Consortium]
Keywords: Anti-PRD, Anti-PEPD, Anti-Prolidase, EC=3.4.13.9, Anti-Peptidase D, Anti-Imidodipeptidase, Anti-X-Pro dipeptidase, Anti-Proline dipeptidase, Anti-Xaa-Pro dipeptidase
Supplier: Arigo Biolaboratories
Supplier-Nr: ARG40851

Properties

Application: IHC (paraffin), WB
Antibody Type: Polyclonal
Conjugate: No
Host: Rabbit
Species reactivity: human (Expected: human, mouse, rat, cow, dog, goat, guinea pig, horse, rabbit, zebrafish)
Immunogen: Synthetic peptide around the middle region of Human PEPD (within the following region: LGAVFMPHGLGHFLGIDVHDVGGYPEGVERIDEPGLRSLRTARHLQPGMV)
MW: 54 kD
Format: Affinity Purified

Handling & Safety

Storage: -20°C
Shipping: +4°C (International: °C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-PEPD"
Write a review
or to review a product.
Viewed