Anti-PCDH15

Anti-PCDH15
Item number Size Datasheet Manual SDS Delivery time Quantity Price
ARG43089.50 50 µg - -

6 - 14 business days*

551.00€
 
Protein function: Calcium-dependent cell-adhesion protein. Essential for maintenance of normal... more
Product information "Anti-PCDH15"
Protein function: Calcium-dependent cell-adhesion protein. Essential for maintenance of normal retinal and cochlear function. [The UniProt Consortium]
Keywords: Anti-USH1F, Anti-PCDH15, Anti-Protocadherin-15, Anti-Protocadherin-15
Supplier: Arigo Biolaboratories
Supplier-Nr: ARG43089

Properties

Application: FC, IHC (paraffin)
Antibody Type: Polyclonal
Conjugate: No
Host: Rabbit
Species reactivity: human, mouse, rat
Immunogen: Synthetic peptide corresponding to a sequence of Human PCDH15. (DLTVYAIDPQTNRAIDRNELFKFLDGKLLDINKDFQ)
MW: 216 kD
Format: Antigen Affinity Purified

Handling & Safety

Storage: -20°C
Shipping: +4°C (International: °C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-PCDH15"
Write a review
or to review a product.
Viewed