Anti-PAX8

Anti-PAX8
Item number Size Datasheet Manual SDS Delivery time Quantity Price
NSJ-RQ4059 100 µg - -

3 - 10 business days*

790.00€
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Paired box gene 8, also known as PAX8, is... more
Product information "Anti-PAX8"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Paired box gene 8, also known as PAX8, is a protein which in humans is encoded by the PAX8 gene. This gene encodes a member of the paired box (PAX) family of transcription factors. Members of this gene family typically encode proteins that contain a paired box domain, an octapeptide, and a paired-type homeodomain. This nuclear protein is involved in thyroid follicular cell development and expression of thyroid-specific genes. Mutations in this gene have been associated with thyroid dysgenesis, thyroid follicular carcinomas and atypical follicular thyroid adenomas. Alternatively spliced transcript variants encoding different isoforms have been described. Protein function: Transcription factor for the thyroid-specific expression of the genes exclusively expressed in the thyroid cell type, maintaining the functional differentiation of such cells. [The UniProt Consortium]
Keywords: Anti-PAX8, Anti-Paired box protein Pax-8, PAX8 Antibody
Supplier: NSJ Bioreagents
Supplier-Nr: RQ4059

Properties

Application: WB
Antibody Type: Polyclonal
Conjugate: No
Host: Rabbit
Species reactivity: human
Immunogen: Amino acids RKHLRTDAFSQHHLEPLECPFERQHYPEAYASPSHTKGEQ from the human protein were used as the immunogen for the PAX8 antibody.
Format: Purified

Handling & Safety

Storage: +4°C
Shipping: +4°C (International: +4°C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-PAX8"
Write a review
or to review a product.
Viewed