Anti-Otx2

Anti-Otx2
Item number Size Datasheet Manual SDS Delivery time Quantity Price
NSJ-R31757 100 µg - -

7 - 12 business days*

790.00€
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Orthodenticle homeobox 2 is also known as... more
Product information "Anti-Otx2"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Orthodenticle homeobox 2 is also known as CPHD6 or MCOPS5. The OTX2 gene encodes a member of the bicoid subfamily of homeodomain-containing transcription factors. Otx2 acts as a transcription factor and plays a role in brain, craniofacial, and sensory organ development. The encoded protein also influences the proliferation and differentiation of dopaminergic neuronal progenitor cells during mitosis. Mutations in this gene cause syndromic microphthalmia 5 (MCOPS5) and combined pituitary hormone deficiency 6 (CPHD6). Otx2 is also suspected of having an oncogenic role in medulloblastoma. Alternative splicing results in multiple transcript variants encoding distinct isoforms. Pseudogenes of this gene are known to exist on chromosomes two and nine. Protein function: Probably plays a role in the development of the brain and the sense organs. Can bind to the BCD target sequence (BTS): 5'-TCTAATCCC-3'. [The UniProt Consortium]
Keywords: Anti-OTX2, Anti-Homeobox protein OTX2, Anti-Orthodenticle homolog 2, Otx2 Antibody
Supplier: NSJ Bioreagents
Supplier-Nr: R31757

Properties

Application: WB
Antibody Type: Polyclonal
Conjugate: No
Host: Rabbit
Species reactivity: human
Immunogen: An amino acid sequence from the C-terminus of human Orthodenticle homeobox 2 (DYKDQTASWKLNFNADCLDYKDQTSSWKFQVL) was used as the immunogen for this Otx2 antibody (100% mouse homology).
Format: Purified

Handling & Safety

Storage: +4°C
Shipping: +4°C (International: +4°C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-Otx2"
Write a review
or to review a product.
Viewed