Anti-Osteoprotegerin (Tumor Necrosis Factor Receptor Superfamily Member 11B, Osteoclastogenesis Inhi

Anti-Osteoprotegerin (Tumor Necrosis Factor Receptor Superfamily Member 11B, Osteoclastogenesis Inhi
Item number Size Datasheet Manual SDS Delivery time Quantity Price
130764.100 100 µg - -

3 - 19 business days*

943.00€
 
Human OPG (Osteoprotegerin), also known as OCIF (Osteoclastogenesis inhibitory factor), is a... more
Product information "Anti-Osteoprotegerin (Tumor Necrosis Factor Receptor Superfamily Member 11B, Osteoclastogenesis Inhi"
Human OPG (Osteoprotegerin), also known as OCIF (Osteoclastogenesis inhibitory factor), is a member of the TNF receptor superfamily. It specifically acts on bone tissues and increases bone mineral density and bone volume associated with a decrease of active osteoclast number. Human OPG is a 20kD protein, comprising of 174aa residues. Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MNNLLCCALVFLDISIKWTTQETFPPKYLHYDEETSHQLLCDKCPPGTYLKQHCTAKWKTVCAPCPDHYYTDSWHTSDECLYCSPVCKELQYVKQECNRTHNRVCECKEGRYLEIEFCLKHRSCPPGFGVVQAGTPERNTVCKRCPDGFFSNETSSKAPCRKHTNCSVFGLLLTQKGNATHDNICSGNSESTQKCGIDVTLCEEAFFRFAVPTKFTPNWLSVLVDNLPGTKVNAESVERIKRQHSSQEQTFQLLKLWKHQNKDQDIVKKIIQDIDLCENSVQRHIGHANLTFEQLRSLMESLPGKKVGAEDIEKTIKACKPSDQILKLLSLWRIKNGDQDTLKGLMHALKHSKTYHFPKTVTQSLKKTIRFLHSFTMYKLYQKLFLEMIGNQVQSVKISCL, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Supplier: United States Biological
Supplier-Nr: 130764

Properties

Application: WB
Antibody Type: Polyclonal
Conjugate: No
Host: Rabbit
Species reactivity: human
Immunogen: Full length human TNFRSF11B, aa1-401 (AAH30155.1).
Purity: Purified by Protein A affinity chromatography.
Format: Affinity Purified

Handling & Safety

Storage: -20°C
Shipping: +4°C (International: +4°C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-Osteoprotegerin (Tumor Necrosis Factor Receptor Superfamily Member 11B, Osteoclastogenesis Inhi"
Write a review
or to review a product.
Viewed