Anti-OGG1 / 8-Oxoguanine glycosylase

Anti-OGG1 / 8-Oxoguanine glycosylase
Item number Size Datasheet Manual SDS Delivery time Quantity Price
NSJ-RQ4046 100 µg - -

3 - 10 business days*

790.00€
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. 8-Oxoguanine glycosylase also known as... more
Product information "Anti-OGG1 / 8-Oxoguanine glycosylase"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. 8-Oxoguanine glycosylase also known as OGG1 is a DNA glycosylase enzyme that, in humans, is encoded by theOGG1 gene. This gene encodes the enzyme responsible for the excision of 8-oxoguanine, a mutagenic base byproduct which occurs as a result of exposure to reactive oxygen. The action of this enzyme includes lyase activity for chain cleavage. Alternative splicing of the C-terminal region of this gene classifies splice variants into two major groups, type 1 and type 2, depending on the last exon of the sequence. Type 1 alternative splice variants end with exon 7 and type 2 end with exon 8. All variants share the N-terminal region in common, which contains a mitochondrial targeting signal that is essential for mitochondrial localization. Many alternative splice variants for this gene have been described, but the full-length nature for every variant has not been determined.
Keywords: Anti-OGG1, Anti-N-glycosylase/DNA lyase, OGG1 Antibody / 8-Oxoguanine glycosylase
Supplier: NSJ Bioreagents
Supplier-Nr: RQ4046

Properties

Application: WB, IF, IHC (paraffin), IP
Antibody Type: Polyclonal
Conjugate: No
Host: Rabbit
Species reactivity: human
Immunogen: Amino acids KYFQLDVTLAQLYHHWGSVDSHFQEVAQKFQGVRLLRQD from the human protein
Format: Purified

Handling & Safety

Storage: +4°C
Shipping: +4°C (International: +4°C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-OGG1 / 8-Oxoguanine glycosylase"
Write a review
or to review a product.
Viewed