Anti-OAS1

Item number Size Datasheet Manual SDS Delivery time Quantity Price
ARG40517.50 50 µl - -

6 - 14 business days*

584.00€
 
Protein function: Interferon-induced, dsRNA-activated antiviral enzyme which plays a critical... more
Product information "Anti-OAS1"
Protein function: Interferon-induced, dsRNA-activated antiviral enzyme which plays a critical role in cellular innate antiviral response. In addition, it may also play a role in other cellular processes such as apoptosis, cell growth, differentiation and gene regulation. Synthesizes higher oligomers of 2'-5'-oligoadenylates (2-5A) from ATP which then bind to the inactive monomeric form of ribonuclease L (RNase L) leading to its dimerization and subsequent activation. Activation of RNase L leads to degradation of cellular as well as viral RNA, resulting in the inhibition of protein synthesis, thus terminating viral replication. Can mediate the antiviral effect via the classical RNase L-dependent pathway or an alternative antiviral pathway independent of RNase L. The secreted form displays antiviral effect against vesicular stomatitis virus (VSV), herpes simplex virus type 2 (HSV-2), and encephalomyocarditis virus (EMCV) and stimulates the alternative antiviral pathway independent of RNase L. [The UniProt Consortium]
Keywords: Anti-OAS1, Anti-OIAS, Anti-E18/E16, Anti-p46/p42 OAS, Anti-2-5A synthase 1, Anti-(2-5')oligo(A) synthase 1, Anti-2'-5'-oligoadenylate synthase 1
Supplier: Arigo Biolaboratories
Supplier-Nr: ARG40517

Properties

Application: IHC (paraffin), WB
Antibody Type: Polyclonal
Conjugate: No
Host: Rabbit
Species reactivity: human (Expected: mouse, rat, cow, dog, horse, swine, rabbit)
Immunogen: Synthetic peptide around the N-terminal region of Human OAS1. (within the following region: MMDLRNTPAKSLDKFIEDYLLPDTCFRMQINHAIDIICGFLKERCFRGSS)
MW: 46 kD
Format: Affinity Purified

Handling & Safety

Storage: -20°C
Shipping: +4°C (International: °C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-OAS1"
Write a review
or to review a product.
Viewed