Anti-NUCB1 / Nucleobindin 1

Anti-NUCB1 / Nucleobindin 1
Item number Size Datasheet Manual SDS Delivery time Quantity Price
ARG40516.50 50 µl - -

6 - 14 business days*

584.00€
 
Protein function: Major calcium-binding protein of the Golgi. May have a role in calcium... more
Product information "Anti-NUCB1 / Nucleobindin 1"
Protein function: Major calcium-binding protein of the Golgi. May have a role in calcium homeostasis. [The UniProt Consortium]
Keywords: Anti-Nuc, Anti-Nucb1, Anti-CALNUC, Anti-Nucleobindin-1, Anti-Bone 63 kDa calcium-binding protein
Supplier: Arigo Biolaboratories
Supplier-Nr: ARG40516

Properties

Application: IHC (paraffin)
Antibody Type: Polyclonal
Conjugate: No
Host: Rabbit
Species reactivity: rat (Expected: mouse, dog)
Immunogen: Synthetic peptide corresponding to a region of Rat NUCB1 / Nucleobindin 1. (within the following region: SQPDGQLQFRADTGDAPVPAPAGDQKDVPASEKKVPEQPPVLPQLDSQHL)
Format: Purified

Handling & Safety

Storage: -20°C
Shipping: +4°C (International: °C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-NUCB1 / Nucleobindin 1"
Write a review
or to review a product.
Viewed