Anti-NPY / Neuropeptide Y

Anti-NPY / Neuropeptide Y
Item number Size Datasheet Manual SDS Delivery time Quantity Price
NSJ-R31709 100 µg - -

3 - 10 business days*

790.00€
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Neuropeptide Y is widely expressed in the... more
Product information "Anti-NPY / Neuropeptide Y"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Neuropeptide Y is widely expressed in the central nervous system and influences many physiological processes, including cortical excitability, stress response, food intake, circadian rhythms, and cardiovascular function. The neuropeptide functions through G protein-coupled receptors to inhibit adenylyl cyclase, activate mitogen-activated protein kinase (MAPK), regulate intracellular calcium levels, and activate potassium channels. A polymorphism in this gene resulting in a change of leucine 7 to proline in the signal peptide is associated with elevated cholesterol levels, higher alcohol consumption, and may be a risk factor for various metabolic and cardiovascular diseases. Neuropeptide Y also exhibits antimicrobial activity against bacteria and fungi. Protein function: NPY is implicated in the control of feeding and in secretion of gonadotrophin-release hormone. [The UniProt Consortium]
Keywords: Anti-NPY, NPY Antibody / Neuropeptide Y
Supplier: NSJ Bioreagents
Supplier-Nr: R31709

Properties

Application: IHC (paraffin)
Antibody Type: Polyclonal
Conjugate: No
Host: Rabbit
Species reactivity: human, mouse, rat
Immunogen: Amino acid sequence from the middle region of human Neuropeptide Y (YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY)
Format: Purified

Handling & Safety

Storage: +4°C
Shipping: +4°C (International: +4°C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-NPY / Neuropeptide Y"
Write a review
or to review a product.
Viewed