Anti-NOV (Protein NOV Homolog, NovH, Insulin-like Growth Factor-binding Protein 9, IGF-binding Prote

Anti-NOV (Protein NOV Homolog, NovH, Insulin-like Growth Factor-binding Protein 9, IGF-binding Prote
Item number Size Datasheet Manual SDS Delivery time Quantity Price
130482.100 100 µg - -

9 - 20 business days*

850.00€
 
NOV is a small secreted cysteine-rich protein and a member of the CCN family of regulatory... more
Product information "Anti-NOV (Protein NOV Homolog, NovH, Insulin-like Growth Factor-binding Protein 9, IGF-binding Prote"
NOV is a small secreted cysteine-rich protein and a member of the CCN family of regulatory proteins. CNN family proteins associate with the extracellular matrix and play an important role in cardiovascular and skeletal development, fibrosis and cancer development. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MQSVQSTSFCLRKQCLCLTFLLLHLLGQVAATQRCPPQCPGRCPATPPTCAPGVRAVLDGCSCCLVCARQRGESCSDLEPCDEGSGLYCDRSADPSKQTGICTAVEGDNCVFDGVIYRSGEKFQPSCKFQCTCRDGQIGCVPRCQLDVLLPEPNCPAPRKVEVPGECCEKWICGPDEEDSLGGLTLAAYRPEATLGVEVSDSSVNCIEQTTEWTACSKSCGMGFSTRVTNRNRQCEMLKQTRLCMVRPCEQEPEQPTDKKGKKCLRTKKSLKAIHLQFKNCTSLHTYKPRFCGVCSDGRCCTPHNTKTIQAEFQCSPGQIVKKPVMVIGTCTCHTNCPKNNEAFLQELELKTTRGKM, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Supplier: United States Biological
Supplier-Nr: 130482

Properties

Application: ELISA, WB
Antibody Type: Monoclonal
Clone: 3C2
Conjugate: No
Host: Mouse
Species reactivity: human
Format: Affinity Purified

Database Information

Handling & Safety

Storage: -20°C
Shipping: +4°C (International: °C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-NOV (Protein NOV Homolog, NovH, Insulin-like Growth Factor-binding Protein 9, IGF-binding Prote"
Write a review
or to review a product.
Viewed