Anti-NME3 / nm23 H3

Item number	Size	Datasheet	Manual	SDS	Delivery time	Quantity	Price
ARG40424.50	50 µl		-	-	6 - 14 business days*		584.00€

If you have any questions, please use our Contact Form.
You can also order by e-mail: info@biomol.com
Larger quantity required? Request bulk

Protein function: Major role in the synthesis of nucleoside triphosphates other than ATP. The ATP... more

Close menu

Product information "Anti-NME3 / nm23 H3"

Protein function: Major role in the synthesis of nucleoside triphosphates other than ATP. The ATP gamma phosphate is transferred to the NDP beta phosphate via a ping-pong mechanism, using a phosphorylated active-site intermediate. Probably has a role in normal hematopoiesis by inhibition of granulocyte differentiation and induction of apoptosis. [The UniProt Consortium]

Keywords:	Anti-NME3, Anti-NDPKC, Anti-NDK 3, Anti-nm23-H3, Anti-DR-nm23, EC=2.7.4.6, Anti-NDP kinase 3, Anti-Nucleoside diphosphate kinase 3, Anti-Nucleoside diphosphate kinase C
Supplier:	Arigo Biolaboratories
Supplier-Nr:	ARG40424

Properties

Application:	WB
Antibody Type:	Polyclonal
Conjugate:	No
Host:	Rabbit
Species reactivity:	human
Immunogen:	Synthetic peptide around the N-terminal region of Human NME3 / nm23 H3. (within the following region: CLVLTIFANLFPAACTGAHERTFLAVKPDGVQRRLVGEIVRRFERKGFKL)
MW:	19 kD
Format:	Affinity Purified