Anti-NME1 / NM23

Anti-NME1 / NM23
Item number Size Datasheet Manual SDS Delivery time Quantity Price
NSJ-R31976 100 µg - -

3 - 10 business days*

790.00€
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. NME1, also called NM23, NM23-H1, NDPKA,... more
Product information "Anti-NME1 / NM23"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. NME1, also called NM23, NM23-H1, NDPKA, GAAD or AWD, is an enzyme that in humans is encoded by the NME1 gene. The promoters of the mouse and human NME1 genes, like those of other NME genes, contain several binding sites for AP2, NF1, Sp1, LEF1, and response elements to glucocorticoid receptors. The NME1 gene is mapped on 17q21.33. Immunofluorescence microscopy demonstrated colocalization of NME1 in nuclei of B cells expressing EBNA3C. Expression of EBNA3C reversed the ability of NME1 to inhibit migration of BL and breast carcinoma cells. NM23H1 bound SET and was released from inhibition by GZMA cleavage of SET. After GZMA loading or cytotoxic T lymphocyte attack, SET and NM23H1 translocated to the nucleus and SET was degraded, allowing NM23H1 to nick chromosomal DNA. Using a Drosophila model system, Dammai et al. (2003) showed that the Drosophila NME1 homolog, awd, regulates trachea cell motility by modulating FGFR levels through a dynamin -mediated pathway. Protein function: Major role in the synthesis of nucleoside triphosphates other than ATP. The ATP gamma phosphate is transferred to the NDP beta phosphate via a ping-pong mechanism, using a phosphorylated active-site intermediate. Possesses nucleoside-diphosphate kinase, serine/threonine-specific protein kinase, geranyl and farnesyl pyrophosphate kinase, histidine protein kinase and 3'-5' exonuclease activities. Involved in cell proliferation, differentiation and development, signal transduction, G protein- coupled receptor endocytosis, and gene expression. Required for neural development including neural patterning and cell fate determination. During GZMA-mediated cell death, works in concert with TREX1. NME1 nicks one strand of DNA and TREX1 removes bases from the free 3' end to enhance DNA damage and prevent DNA end reannealing and rapid repair. [The UniProt Consortium]
Keywords: Anti-NME1, Anti-GAAD, Anti-NDPKA, Anti-NDK A, Anti-NM23-H1, EC=2.7.4.6, Anti-NDP kinase A, Anti-Granzyme A-activated DNase, Anti-Nucleoside diphosphate kinase A, Anti-Metastasis inhibition factor nm23, Anti-Tumor metastatic process-associated protein, NME
Supplier: NSJ Bioreagents
Supplier-Nr: R31976

Properties

Application: WB, FC
Antibody Type: Polyclonal
Conjugate: No
Host: Rabbit
Species reactivity: human, mouse, rat
Immunogen: Amino acids KRFEQKGFRLVGLKFMQASEDLLKEHYVDLKDR of human NM23A were used as the immunogen for the NM23 antibody.
Format: Purified

Handling & Safety

Storage: +4°C
Shipping: +4°C (International: +4°C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-NME1 / NM23"
Write a review
or to review a product.
Viewed