Anti-NME1 (NDPKA, NM23, Nucleoside Diphosphate Kinase A, NDK A, NDP Kinase A, Granzyme A-activated D

Anti-NME1 (NDPKA, NM23, Nucleoside Diphosphate Kinase A, NDK A, NDP Kinase A, Granzyme A-activated D
Item number Size Datasheet Manual SDS Delivery time Quantity Price
130418.100 100 µg - -

3 - 19 business days*

761.00€
 
This gene (NME1) was identified because of its reduced mRNA transcript levels in highly... more
Product information "Anti-NME1 (NDPKA, NM23, Nucleoside Diphosphate Kinase A, NDK A, NDP Kinase A, Granzyme A-activated D"
This gene (NME1) was identified because of its reduced mRNA transcript levels in highly metastatic cells. Nucleoside diphosphate kinase (NDK) exists as a hexamer composed of 'A' (encoded by this gene) and 'B' (encoded by NME2) isoforms. Mutations in this gene have been identified in aggressive neuroblastomas. Two transcript variants encoding different isoforms have been found for this gene. Co-transcription of this gene and the neighboring downstream gene (NME2) generates naturally-occurring transcripts (NME1-NME2), which encodes a fusion protein comprised of sequence sharing identity with each individual gene product. Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MVLLSTLGIVFQGEGPPISSCDTGTMANCERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVGLKFMQASEDLLKEHYVDLKDRPFFAGLVKYMHSGPVVAMVWEGLNVVKTGRVMLGETNPADSKPGTIRGDFCIQVGRNIIHGSDSVESAEKEIGLWFHPEELVDYTSCAQNWIYE, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Supplier: United States Biological
Supplier-Nr: 130418

Properties

Application: WB
Antibody Type: Polyclonal
Conjugate: No
Host: Rabbit
Species reactivity: human
Immunogen: Full length human NME1, aa1-177.
Purity: Purified by Protein A affinity chromatography.
Format: Affinity Purified

Handling & Safety

Storage: -20°C
Shipping: +4°C (International: +4°C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-NME1 (NDPKA, NM23, Nucleoside Diphosphate Kinase A, NDK A, NDP Kinase A, Granzyme A-activated D"
Write a review
or to review a product.
Viewed