Anti-Neuroserpin

Anti-Neuroserpin
Item number Size Datasheet Manual SDS Delivery time Quantity Price
ARG59897.50 50 µg - -

10 - 15 business days*

551.00€
 
Protein function: Serine protease inhibitor that inhibits plasminogen activators and plasmin but... more
Product information "Anti-Neuroserpin"
Protein function: Serine protease inhibitor that inhibits plasminogen activators and plasmin but not thrombin (PubMed:9442076, PubMed:26329378, PubMed:19265707, PubMed:19285087, PubMed:11880376). May be involved in the formation or reorganization of synaptic connections as well as for synaptic plasticity in the adult nervous system. May protect neurons from cell damage by tissue-type plasminogen activator (Probable). [The UniProt Consortium]
Keywords: Anti-PI12, Anti-PI-12, Anti-SERPINI1, Anti-Serpin I1, Anti-Neuroserpin, Anti-Peptidase inhibitor 12
Supplier: Arigo Biolaboratories
Supplier-Nr: ARG59897

Properties

Application: WB
Antibody Type: Polyclonal
Conjugate: No
Host: Rabbit
Species reactivity: human, mouse, rat
Immunogen: Synthetic peptide corresponding to aa. 272-310 of Human Neuroserpin. (KAQLVEEWANSVKKQKVEVYLPRFTVEQEIDLKDVLKAL)
MW: 46 kD
Format: Antigen Affinity Purified

Handling & Safety

Storage: -20°C
Shipping: +4°C (International: °C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-Neuroserpin"
Write a review
or to review a product.
Viewed