Anti-Neuropeptide Y

Item number Size Datasheet Manual SDS Delivery time Quantity Price
ARG57559.50 50 µg - -

6 - 14 business days*

559.00€
 
Protein function: NPY is implicated in the control of feeding and in secretion of... more
Product information "Anti-Neuropeptide Y"
Protein function: NPY is implicated in the control of feeding and in secretion of gonadotrophin-release hormone. [The UniProt Consortium]
Keywords: Anti-NPY
Supplier: Arigo Biolaboratories
Supplier-Nr: ARG57559

Properties

Application: IHC (paraffin)
Antibody Type: Polyclonal
Conjugate: No
Host: Rabbit
Species reactivity: human, mouse, rat
Immunogen: Synthetic peptide around the center region of Human Neuropeptide Y. (YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY)
Format: Antigen Affinity Purified

Handling & Safety

Storage: -20°C
Shipping: +4°C (International: °C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-Neuropeptide Y"
Write a review
or to review a product.
Viewed