Anti-NEDD8

Item number	Size	Datasheet	Manual	SDS	Delivery time	Quantity	Price
ARG59010.50	50 µg		-	-	6 - 14 business days*		520.00€

If you have any questions, please use our Contact Form.
You can also order by e-mail: info@biomol.com
Larger quantity required? Request bulk

Protein function: Ubiquitin-like protein which plays an important role in cell cycle control and... more

Close menu

Product information "Anti-NEDD8"

Protein function: Ubiquitin-like protein which plays an important role in cell cycle control and embryogenesis. Covalent attachment to its substrates requires prior activation by the E1 complex UBE1C- APPBP1 and linkage to the E2 enzyme UBE2M. Attachment of NEDD8 to cullins activates their associated E3 ubiquitin ligase activity, and thus promotes polyubiquitination and proteasomal degradation of cyclins and other regulatory proteins. [The UniProt Consortium]

Keywords:	Anti-NEDD8, Anti-NEDD-8, Anti-Neddylin, Anti-Ubiquitin-like protein Nedd8, Anti-Neural precursor cell expressed developmentally down-regulated protein 8
Supplier:	Arigo Biolaboratories
Supplier-Nr:	ARG59010

Properties

Application:	IHC (paraffin), WB
Antibody Type:	Polyclonal
Conjugate:	No
Host:	Rabbit
Species reactivity:	human, mouse, rat
Immunogen:	Synthetic peptide corresponding to aa. 20-60 of Human NEDD8 (TDKVERIKERVEEKEGIPPQQQRLIYSGKQMNDEKTAADYK)
MW:	9 kD
Format:	Antigen Affinity Purified