Cookie preferences
This website uses cookies, which are necessary for the technical operation of the website and are always set. Other cookies, which increase the comfort when using this website, are used for direct advertising or to facilitate interaction with other websites and social networks, are only set with your consent.
Configuration
Technically required
These cookies are necessary for the basic functions of the shop.
"Allow all cookies" cookie
"Decline all cookies" cookie
CSRF token
Cookie preferences
Currency change
Customer-specific caching
FACT-Finder tracking
Individual prices
Selected shop
Session
Comfort functions
These cookies are used to make the shopping experience even more appealing, for example for the recognition of the visitor.
Note
Show the facebook fanpage in the right blod sidebar
Statistics & Tracking
Affiliate program
Conversion and usertracking via Google Tag Manager
Track device being used
| Item number | Size | Datasheet | Manual | SDS | Delivery time | Quantity | Price |
|---|---|---|---|---|---|---|---|
| NSJ-R32787 | 100 µg | - | - |
3 - 10 business days* |
790.00€
|
If you have any questions, please use our Contact Form.
You can also order by e-mail: info@biomol.com
Larger quantity required? Request bulk
You can also order by e-mail: info@biomol.com
Larger quantity required? Request bulk
0.5mg/ml if reconstituted with 0.2ml sterile DI water. NMDA receptor-regulated protein 1 (NARG1),... more
Product information "Anti-NARG1 / NAA15"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. NMDA receptor-regulated protein 1 (NARG1), also known as GA19 or Tbdn100 is a protein that in humans is encoded by the NAA15 gene. It is mapped to chromosome 4. NARG1 is the auxiliary subunit of the NatA (N-alpha-acetyltransferase A) complex. Both, Naa15 and Naa16 interact with the ribosome in yeast (via the ribosomal proteins, uL23 and uL29), humans and rat, thereby linking the NatA/Naa10 to the ribosome and facilitating co-translational acetylation of nascent polypeptide chains as they emerges from the exit tunnel. Furthermore, Naa15 might act as a scaffold for other factors, including the chaperone like protein HYPK (Huntingtin Interacting Protein K) and Naa50, the catalytic acetyltransferase subunit of NatE. Protein function: Auxillary subunit of the N-terminal acetyltransferase A (NatA) complex which displays alpha (N-terminal) acetyltransferase activity. The NAT activity may be important for vascular, hematopoietic and neuronal growth and development. Required to control retinal neovascularization in adult ocular endothelial cells. In complex with XRCC6 and XRCC5 (Ku80), up-regulates transcription from the osteocalcin promoter. [The UniProt Consortium]
| Keywords: | Anti-GA19, Anti-NAA15, Anti-Tbdn100, Anti-Protein tubedown-1, Anti-Gastric cancer antigen Ga19, Anti-N-terminal acetyltransferase, Anti-NMDA receptor-regulated protein 1, Anti-N-alpha-acetyltransferase 15, NatA auxiliary subunit, NARG1 Antibody / NAA15 |
| Supplier: | NSJ Bioreagents |
| Supplier-Nr: | R32787 |
Properties
| Application: | WB, IHC (paraffin) |
| Antibody Type: | Polyclonal |
| Conjugate: | No |
| Host: | Rabbit |
| Species reactivity: | human, mouse |
| Immunogen: | Amino acids 244-287 (ADVYRGLQERNPENWAYYKGLEKALKPANMLERLKIYEEAWTKY) from the human protein |
| Format: | Purified |
Database Information
| KEGG ID : | K20792 | Matching products |
| UniProt ID : | Q9BXJ9 | Matching products |
| Gene ID : | GeneID 80155 | Matching products |
Handling & Safety
| Storage: | +4°C |
| Shipping: | +4°C (International: +4°C) |
Caution
Our products are for laboratory research use only: Not for administration to humans!
Our products are for laboratory research use only: Not for administration to humans!
Information about the product reference will follow.
more
You will get a certificate here
Viewed