Anti-NARG1 / NAA15

Anti-NARG1 / NAA15
Item number Size Datasheet Manual SDS Delivery time Quantity Price
NSJ-R32787 100 µg - -

3 - 10 business days*

790.00€
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. NMDA receptor-regulated protein 1 (NARG1),... more
Product information "Anti-NARG1 / NAA15"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. NMDA receptor-regulated protein 1 (NARG1), also known as GA19 or Tbdn100 is a protein that in humans is encoded by the NAA15 gene. It is mapped to chromosome 4. NARG1 is the auxiliary subunit of the NatA (N-alpha-acetyltransferase A) complex. Both, Naa15 and Naa16 interact with the ribosome in yeast (via the ribosomal proteins, uL23 and uL29), humans and rat, thereby linking the NatA/Naa10 to the ribosome and facilitating co-translational acetylation of nascent polypeptide chains as they emerges from the exit tunnel. Furthermore, Naa15 might act as a scaffold for other factors, including the chaperone like protein HYPK (Huntingtin Interacting Protein K) and Naa50, the catalytic acetyltransferase subunit of NatE. Protein function: Auxillary subunit of the N-terminal acetyltransferase A (NatA) complex which displays alpha (N-terminal) acetyltransferase activity. The NAT activity may be important for vascular, hematopoietic and neuronal growth and development. Required to control retinal neovascularization in adult ocular endothelial cells. In complex with XRCC6 and XRCC5 (Ku80), up-regulates transcription from the osteocalcin promoter. [The UniProt Consortium]
Keywords: Anti-GA19, Anti-NAA15, Anti-Tbdn100, Anti-Protein tubedown-1, Anti-Gastric cancer antigen Ga19, Anti-N-terminal acetyltransferase, Anti-NMDA receptor-regulated protein 1, Anti-N-alpha-acetyltransferase 15, NatA auxiliary subunit, NARG1 Antibody / NAA15
Supplier: NSJ Bioreagents
Supplier-Nr: R32787

Properties

Application: WB, IHC (paraffin)
Antibody Type: Polyclonal
Conjugate: No
Host: Rabbit
Species reactivity: human, mouse
Immunogen: Amino acids 244-287 (ADVYRGLQERNPENWAYYKGLEKALKPANMLERLKIYEEAWTKY) from the human protein
Format: Purified

Handling & Safety

Storage: +4°C
Shipping: +4°C (International: +4°C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-NARG1 / NAA15"
Write a review
or to review a product.
Viewed