Anti-NAE1 (NEDD8 Activating Enzyme E1 Subunit 1, A-116A10.1, APPBP1, HPP1, ula-1)

Anti-NAE1 (NEDD8 Activating Enzyme E1 Subunit 1, A-116A10.1, APPBP1, HPP1, ula-1)
Item number Size Datasheet Manual SDS Delivery time Quantity Price
249117.100 100 µg - -

5 - 10 business days*

850.00€
 
The protein encoded by this gene binds to the beta-amyloid precursor protein. Beta-amyloid... more
Product information "Anti-NAE1 (NEDD8 Activating Enzyme E1 Subunit 1, A-116A10.1, APPBP1, HPP1, ula-1)"
The protein encoded by this gene binds to the beta-amyloid precursor protein. Beta-amyloid precursor protein is a cell surface protein with signal-transducing properties, and it is thought to play a role in the pathogenesis of Alzheimer's disease. In addition, the encoded protein can form a heterodimer with UBE1C and bind and activate NEDD8, a ubiquitin-like protein. This protein is required for cell cycle progression through the S/M checkpoint. Three transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MAQLGKLLKEQKYDRQLRLWGDHGQEALESAHVCLINATATGTEILKNLVLPGIGSFTIIDGNQVSGEDAGNNFFLQRSSIGKNRAEAAMEFLQELNSDVSGSFVEESPENLLDNDPSFFCRFTVVVATQLPESTSLRLADVLWNSQIPLLICRTYGLVGYMRIIIKEHPVIESHPDNALEDLRLDKPFPELREHFQSYDLDHMEKKDHSHTPWIVIIAKYLAQWYSETNGRIPKTYKEKEDFRDLIRQGILKNENGAPEDEENFEEAIKNVNTALNTTQIPSSIEDIFNDDRCINITKQTPSFWILARALKEFVAKEGQGNLPVRGTIPDMIADSGKYIKLQNVYREKAKKDMouse monoclonal antibody raised against a full-length recombinant NAE1.VGNHVAKLLQSIGQAPESISEKELKLLCSNSAFLRVVRCRSLAEEYGLDTINKDEIISSMDNPDNEIVLYLMLRAVDRFHKQQGRYPGVSNYQVEEDIGKLKSCLTGFLQEYGLSVMVKDDYVHEFCRYGAAEPHTIAAFLGGMouse monoclonal antibody raised against a full-length recombinant NAE1.QEVIKIITKQFVIFNNTYIYSGMSQTSATFQL, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Supplier: United States Biological
Supplier-Nr: 249117

Properties

Application: ELISA, WB
Antibody Type: Monoclonal
Clone: 2E9-D12
Conjugate: No
Host: Mouse
Species reactivity: human
Immunogen: NAE1 (AAH00480, 1aa-534aa) full-length recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Format: Purified

Database Information

Handling & Safety

Storage: -20°C
Shipping: +4°C (International: °C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-NAE1 (NEDD8 Activating Enzyme E1 Subunit 1, A-116A10.1, APPBP1, HPP1, ula-1)"
Write a review
or to review a product.
Viewed