Anti-NAA15 / NARG1

Item number Size Datasheet Manual SDS Delivery time Quantity Price
ARG59437.50 50 µg - -

6 - 14 business days*

520.00€
 
Protein function: Auxillary subunit of the N-terminal acetyltransferase A (NatA) complex which... more
Product information "Anti-NAA15 / NARG1"
Protein function: Auxillary subunit of the N-terminal acetyltransferase A (NatA) complex which displays alpha (N-terminal) acetyltransferase activity. The NAT activity may be important for vascular, hematopoietic and neuronal growth and development. Required to control retinal neovascularization in adult ocular endothelial cells. In complex with XRCC6 and XRCC5 (Ku80), up-regulates transcription from the osteocalcin promoter. [The UniProt Consortium]
Keywords: Anti-GA19, Anti-NAA15, Anti-Tbdn100, Anti-Protein tubedown-1, Anti-Gastric cancer antigen Ga19, Anti-N-terminal acetyltransferase, Anti-NMDA receptor-regulated protein 1, Anti-N-alpha-acetyltransferase 15, NatA auxiliary subunit
Supplier: Arigo Biolaboratories
Supplier-Nr: ARG59437

Properties

Application: IHC (paraffin), WB
Antibody Type: Polyclonal
Conjugate: No
Host: Rabbit
Species reactivity: human, mouse
Immunogen: Synthetic peptide corresponding to aa. 244-287 of Human NAA15 / NARG1. (ADVYRGLQERNPENWAYYKGLEKALKPANMLERLKIYEEAWTKY)
MW: 101 kD
Format: Antigen Affinity Purified

Handling & Safety

Storage: -20°C
Shipping: +4°C (International: °C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-NAA15 / NARG1"
Write a review
or to review a product.
Viewed