Anti-MYST2 (MYST histone acetyltransferase 2)

Anti-MYST2 (MYST histone acetyltransferase 2)
Item number Size Datasheet Manual SDS Delivery time Quantity Price
130102.100 100 µg - -

3 - 19 business days*

699.00€
 
Component of the HBO1 complex which has a histone H4-specific acetyltransferase activity, a... more
Product information "Anti-MYST2 (MYST histone acetyltransferase 2)"
Component of the HBO1 complex which has a histone H4-specific acetyltransferase activity, a reduced activity toward histone H3 and is responsible for the bulk of histone H4 acetylation in vivo. Through chromatin acetylation it may regulate DNA replication and act as a coactivator of TP53-dependent transcription. Specifically represses AR-mediated transcription. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: SDLGLISYRSYWKEVLLRYLHNFQGKEISIKEISQETAVNPVDIVSTLQALQMLKYWKGKHLVLKRQDLIDEWIAKEAKRSNSNKTMDPSCLKWTPPKGT, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Supplier: United States Biological
Supplier-Nr: 130102

Properties

Application: ELISA, WB
Antibody Type: Monoclonal
Clone: 2G5
Conjugate: No
Host: Mouse
Species reactivity: human
Immunogen: Partial recombinant corresponding to aa512-611 from MYST2 (AAH32640) with GST tag. MW of the GST tag alone is 26kD.
Purity: Purified by Protein A affinity chromatography.
Format: Affinity Purified

Handling & Safety

Storage: -20°C
Shipping: +4°C (International: +4°C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-MYST2 (MYST histone acetyltransferase 2)"
Write a review
or to review a product.
Viewed