Anti-MYH6 / Myosin 6

Item number Size Datasheet Manual SDS Delivery time Quantity Price
NSJ-RQ6780 100 µg - -

3 - 10 business days*

755.00€
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Myosin heavy chain, alpha isoform... more
Product information "Anti-MYH6 / Myosin 6"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Myosin heavy chain, alpha isoform (MHC-alpha) is a protein that in humans is encoded by the MYH6 gene. Cardiac muscle myosin is a hexamer consisting of two heavy chain subunits, two light chain subunits, and two regulatory subunits. This gene encodes the alpha heavy chain subunit of cardiac myosin. The gene is located approximately 4kb downstream of the gene encoding the beta heavy chain subunit of cardiac myosin. Mutations in this gene cause familial hypertrophic cardiomyopathy and atrial septal defect 3. Protein function: Muscle contraction. [The UniProt Consortium]
Keywords: Anti-MYH6, Anti-MYHCA, Anti-Myosin-6, Anti-MyHC-alpha, Anti-Myosin heavy chain 6, Anti-Myosin heavy chain, cardiac muscle alpha isoform, MYH6 Antibody / Myosin 6
Supplier: NSJ Bioreagents
Supplier-Nr: RQ6780

Properties

Application: WB, IHC (paraffin), FC
Antibody Type: Polyclonal
Conjugate: No
Host: Rabbit
Species reactivity: human, mouse, rat
Immunogen: Amino acids RTLEDQANEYRVKLEEAQRSLNDFTTQRAKLQ from the human protein
Format: Purified

Handling & Safety

Storage: +4°C
Shipping: +4°C (International: +4°C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-MYH6 / Myosin 6"
Write a review
or to review a product.
Viewed