Cookie preferences
This website uses cookies, which are necessary for the technical operation of the website and are always set. Other cookies, which increase the comfort when using this website, are used for direct advertising or to facilitate interaction with other websites and social networks, are only set with your consent.
Configuration
Technically required
These cookies are necessary for the basic functions of the shop.
"Allow all cookies" cookie
"Decline all cookies" cookie
CSRF token
Cookie preferences
Currency change
Customer-specific caching
FACT-Finder tracking
Individual prices
Selected shop
Session
Comfort functions
These cookies are used to make the shopping experience even more appealing, for example for the recognition of the visitor.
Note
Show the facebook fanpage in the right blod sidebar
Statistics & Tracking
Affiliate program
Conversion and usertracking via Google Tag Manager
Track device being used
Item number | Size | Datasheet | Manual | SDS | Delivery time | Quantity | Price |
---|---|---|---|---|---|---|---|
NSJ-RQ6780 | 100 µg | - | - |
3 - 10 business days* |
755.00€
|
If you have any questions, please use our Contact Form.
You can also order by e-mail: info@biomol.com
Larger quantity required? Request bulk
You can also order by e-mail: info@biomol.com
Larger quantity required? Request bulk
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Myosin heavy chain, alpha isoform... more
Product information "Anti-MYH6 / Myosin 6"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Myosin heavy chain, alpha isoform (MHC-alpha) is a protein that in humans is encoded by the MYH6 gene. Cardiac muscle myosin is a hexamer consisting of two heavy chain subunits, two light chain subunits, and two regulatory subunits. This gene encodes the alpha heavy chain subunit of cardiac myosin. The gene is located approximately 4kb downstream of the gene encoding the beta heavy chain subunit of cardiac myosin. Mutations in this gene cause familial hypertrophic cardiomyopathy and atrial septal defect 3. Protein function: Muscle contraction. [The UniProt Consortium]
Keywords: | Anti-MYH6, Anti-MYHCA, Anti-Myosin-6, Anti-MyHC-alpha, Anti-Myosin heavy chain 6, Anti-Myosin heavy chain, cardiac muscle alpha isoform, MYH6 Antibody / Myosin 6 |
Supplier: | NSJ Bioreagents |
Supplier-Nr: | RQ6780 |
Properties
Application: | WB, IHC (paraffin), FC |
Antibody Type: | Polyclonal |
Conjugate: | No |
Host: | Rabbit |
Species reactivity: | human, mouse, rat |
Immunogen: | Amino acids RTLEDQANEYRVKLEEAQRSLNDFTTQRAKLQ from the human protein |
Format: | Purified |
Database Information
KEGG ID : | K17751 | Matching products |
UniProt ID : | P13533 | Matching products |
Gene ID | GeneID 4624 | Matching products |
Handling & Safety
Storage: | +4°C |
Shipping: | +4°C (International: +4°C) |
Caution
Our products are for laboratory research use only: Not for administration to humans!
Our products are for laboratory research use only: Not for administration to humans!
Information about the product reference will follow.
more
You will get a certificate here
Viewed