Anti-MYH10 / non-muscle Myosin IIB

Anti-MYH10 / non-muscle Myosin IIB
Item number Size Datasheet Manual SDS Delivery time Quantity Price
NSJ-RQ5694 100 µg - -

3 - 10 business days*

790.00€
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. This gene encodes a member of the myosin... more
Product information "Anti-MYH10 / non-muscle Myosin IIB"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. This gene encodes a member of the myosin superfamily. The protein represents a conventional non-muscle myosin, it should not be confused with the unconventional myosin-10 (MYO10). Myosins are actin-dependent motor proteins with diverse functions including regulation of cytokinesis, cell motility, and cell polarity. Mutations in this gene have been associated with May-Hegglin anomaly and developmental defects in brain and heart. Multiple transcript variants encoding different isoforms have been found for this gene. Protein function: Cellular myosin that appears to play a role in cytokinesis, cell shape, and specialized functions such as secretion and capping. Involved with LARP6 in the stabilization of type I collagen mRNAs for CO1A1 and CO1A2. During cell spreading, plays an important role in cytoskeleton reorganization, focal contacts formation (in the central part but not the margins of spreading cells), and lamellipodial extension, this function is mechanically antagonized by MYH9. [The UniProt Consortium]
Keywords: Anti-MYH10, Anti-NMMHC-B, Anti-Myosin-10, Anti-NMMHC-IIB, Anti-NMMHC II-b, Anti-Myosin heavy chain 10, Anti-Non-muscle myosin heavy chain B, Anti-Non-muscle myosin heavy chain IIb, Anti-Myosin heavy chain, non-muscle IIb, Anti-Cellular myosin heavy chain,
Supplier: NSJ Bioreagents
Supplier-Nr: RQ5694

Properties

Application: WB, IHC (paraffin), IF, FC
Antibody Type: Polyclonal
Conjugate: No
Host: Rabbit
Species reactivity: human, mouse, rat
Immunogen: Amino acids QRTGLEDPERYLFVDRAVIYNPATQADWTAKK from the human protein
Format: Purified

Handling & Safety

Storage: +4°C
Shipping: +4°C (International: +4°C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-MYH10 / non-muscle Myosin IIB"
Write a review
or to review a product.
Viewed