Anti-MYF6

Item number Size Datasheet Manual SDS Delivery time Quantity Price
ARG10823.50 50 µl - -

6 - 14 business days*

608.00€
 
Protein function: Involved in muscle differentiation (myogenic factor). Induces fibroblasts to... more
Product information "Anti-MYF6"
Protein function: Involved in muscle differentiation (myogenic factor). Induces fibroblasts to differentiate into myoblasts. Probable sequence specific DNA-binding protein. [The UniProt Consortium]
Keywords: Anti-MYF6, Anti-Myf-6, Anti-BHLHC4, Anti-bHLHc4, Anti-Myogenic factor 6, Anti-Muscle-specific regulatory factor 4, Anti-Class C basic helix-loop-helix protein 4
Supplier: Arigo Biolaboratories
Supplier-Nr: ARG10823

Properties

Application: IHC (paraffin), WB
Antibody Type: Polyclonal
Conjugate: No
Host: Rabbit
Species reactivity: human (Expected: cow, dog, goat, guinea pig, horse, mouse, rabbit, rat, sheep, zebrafish)
Immunogen: Synthetic peptide around the N-terminus of Human MYF6.(PGLQPPHCPGQCLIWACKTCKRKSAPTDRRKAATLRERRRLKKINEAFEA)
MW: 27 kD
Format: Affinity Purified

Handling & Safety

Storage: -20°C
Shipping: +4°C (International: +4°C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-MYF6"
Write a review
or to review a product.
Viewed