Cookie preferences
This website uses cookies, which are necessary for the technical operation of the website and are always set. Other cookies, which increase the comfort when using this website, are used for direct advertising or to facilitate interaction with other websites and social networks, are only set with your consent.
Configuration
Technically required
These cookies are necessary for the basic functions of the shop.
"Allow all cookies" cookie
"Decline all cookies" cookie
CSRF token
Cookie preferences
Currency change
Customer-specific caching
FACT-Finder tracking
Individual prices
Selected shop
Session
Comfort functions
These cookies are used to make the shopping experience even more appealing, for example for the recognition of the visitor.
Note
Show the facebook fanpage in the right blod sidebar
Statistics & Tracking
Affiliate program
Conversion and usertracking via Google Tag Manager
Track device being used
| Item number | Size | Datasheet | Manual | SDS | Delivery time | Quantity | Price |
|---|---|---|---|---|---|---|---|
| ARG40423.50 | 50 µl | - | - |
10 - 15 business days* |
584.00€
|
If you have any questions, please use our Contact Form.
You can also order by e-mail: info@biomol.com
Larger quantity required? Request bulk
You can also order by e-mail: info@biomol.com
Larger quantity required? Request bulk
Protein function: Thick filament-associated protein located in the crossbridge region of... more
Product information "Anti-MYBPC2"
Protein function: Thick filament-associated protein located in the crossbridge region of vertebrate striated muscle a bands. In vitro it binds MHC, F-actin and native thin filaments, and modifies the activity of actin-activated myosin ATPase. It may modulate muscle contraction or may play a more structural role. [The UniProt Consortium]
| Keywords: | Anti-MYBPC2, Anti-MYBPCF, Anti-Fast MyBP-C, Anti-Myosin-binding protein C, fast-type, Anti-C-protein, skeletal muscle fast isoform |
| Supplier: | Arigo Biolaboratories |
| Supplier-Nr: | ARG40423 |
Properties
| Application: | WB |
| Antibody Type: | Polyclonal |
| Conjugate: | No |
| Host: | Rabbit |
| Species reactivity: | human (Expected: mouse, rat, cow, dog, guinea pig, horse) |
| Immunogen: | Synthetic peptide around the N-terminal region of Human MYBPC2. (within the following region: KEAPPEDQSPTAEEPTGVFLKKPDSVSVETGKDAVVVAKVNGKELPDKPT) |
| MW: | 128 kD |
| Format: | Affinity Purified |
Database Information
| KEGG ID : | K12558 | Matching products |
| UniProt ID : | Q14324 | Matching products |
| Gene ID : | GeneID 4606 | Matching products |
Handling & Safety
| Storage: | -20°C |
| Shipping: | +4°C (International: °C) |
Caution
Our products are for laboratory research use only: Not for administration to humans!
Our products are for laboratory research use only: Not for administration to humans!
Information about the product reference will follow.
more
You will get a certificate here
Viewed