Anti-MVD / Mevalonate pyrophosphate decarboxylase

Item number	Size	Datasheet	Manual	SDS	Delivery time	Quantity	Price
NSJ-RQ4089	100 µg		-	-	3 - 10 business days*		790.00€

If you have any questions, please use our Contact Form.
You can also order by e-mail: info@biomol.com
Larger quantity required? Request bulk

0.5mg/ml if reconstituted with 0.2ml sterile DI water. The enzyme mevalonate pyrophosphate... more

Close menu

Product information "Anti-MVD / Mevalonate pyrophosphate decarboxylase"

0.5mg/ml if reconstituted with 0.2ml sterile DI water. The enzyme mevalonate pyrophosphate decarboxylase (MVD, EC 4.1.1.33) catalyzes the conversion of mevalonate pyrophosphate into isopentenyl pyrophosphate. This unusual enzyme decarboxylates and dehydrates its substrate while hydrolyzing ATP. As a unique enzyme in one of the early steps in cholesterol biosynthesis, MVD may be a useful target for drugs aimed at lowering serum cholesterol levels. This gene is mapped to chromosome 16q24.3 based on an alignment of the MVDsequence. Protein function: Performs the first committed step in the biosynthesis of isoprenes. [The UniProt Consortium]

Keywords:	Anti-MVD, Anti-MPD, Anti-MDDase, EC=4.1.1.33, Anti-Diphosphomevalonate decarboxylase, Anti-Mevalonate (diphospho)decarboxylase, Anti-Mevalonate pyrophosphate decarboxylase, MVD Antibody / Mevalonate pyrophosphate decarboxylase
Supplier:	NSJ Bioreagents
Supplier-Nr:	RQ4089

Properties

Application:	WB
Antibody Type:	Polyclonal
Conjugate:	No
Host:	Rabbit
Species reactivity:	human
Immunogen:	Amino acids KDFTEDRIWLNGREEDVGQPRLQACLREIRCLARKRR from the human protein were used as the immunogen for the MVD antibody.
Format:	Purified