Anti-Mullerian Hormone (AMH, Muellerian-inhibiting Factor, Muellerian-inhibiting Substance, MIS

Anti-Mullerian Hormone (AMH, Muellerian-inhibiting Factor, Muellerian-inhibiting Substance, MIS
Item number Size Datasheet Manual SDS Delivery time Quantity Price
A2298-11M.1 1 ml - -

3 - 19 business days*

1,772.00€
 
Anti-mullerian hormone (AMH) is originally classified as a fetal testicular hormone that inhibits... more
Product information "Anti-Mullerian Hormone (AMH, Muellerian-inhibiting Factor, Muellerian-inhibiting Substance, MIS"
Anti-mullerian hormone (AMH) is originally classified as a fetal testicular hormone that inhibits Mullerian duct development. AMH is expressed post-natally by immature Sertoli cells, and to a lesser degree by granulosa cells. AMH plays a role in testicular differentiation and in the regulation of ovarian follicle growth. AMH is a member of the TGF beta superfamily. It is secreted as a homodimeric 140kD disulfide linked precursor that is cleaved to release the mature 30kD homodimer. Applications: Suitable for use in Immunohistochemistry and Western Blot. Other applications not tested. Recommended Dilutions: Immunohistochemistry (Paraffin): 1:20-1:40, Requires antigen retrieval using heat treatment prior to staining of paraffin sections. Sodium citrate buffer, pH 6.0 is recommended., Optimal dilutions to be determined by the researcher. Positive Control Tissue: Ovary, Hybridoma: Sp2/0 myeloma cells with spleen cells from T/O outbred mice. Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Supplier: United States Biological
Supplier-Nr: A2298-11M

Properties

Application: IHC, WB
Antibody Type: Monoclonal
Clone: 10B151
Conjugate: No
Host: Mouse
Species reactivity: human, monkey, mouse, sheep
Immunogen: Synthetic peptide derived from human AMH (VPTAYAGKLLISLSEERISAHHVPNMVATEC).
Format: Supernatant

Database Information

Handling & Safety

Storage: -20°C
Shipping: +4°C (International: +4°C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-Mullerian Hormone (AMH, Muellerian-inhibiting Factor, Muellerian-inhibiting Substance, MIS"
Write a review
or to review a product.
Viewed