Anti-MUC3

Anti-MUC3
Item number Size Datasheet Manual SDS Delivery time Quantity Price
NSJ-R32385 100 µg - -

3 - 10 business days*

755.00€
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. MUC3 consists of two genes, MUC3A and... more
Product information "Anti-MUC3"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. MUC3 consists of two genes, MUC3A and MUC3B, each encoding membrane-bound mucins possessing 2 epidermal growth factor-like domains. The MUC3 gene is mapped to chromosome 7. It was showed that synthetic peptide-mediated upregulation of MUC3 dramatically inhibited adherence of enteropathogenic E. coli or enterohemorrhage E. coli serotype O157:H7 to HT-29 human intestinal epithelial cells. Peptide stimulation altered expression of a number of transcription factors, including upregulation of SP1, CREB1, and CDX2. These transcription factors bound to consensus sites in the MUC3 promoter upon peptide stimulation and likely mediated MUC3 upregulation. Protein function: Major glycoprotein component of a variety of mucus gels. Thought to provide a protective, lubricating barrier against particles and infectious agents at mucosal surfaces. May be involved in ligand binding and intracellular signaling. [The UniProt Consortium]
Keywords: Anti-MUC-3A, Anti-Mucin-3A, Anti-Intestinal mucin-3A, MUC3 Antibody
Supplier: NSJ Bioreagents
Supplier-Nr: R32385

Properties

Application: WB
Antibody Type: Polyclonal
Conjugate: No
Host: Rabbit
Species reactivity: human
Immunogen: Amino acids DLNDNTSQAYRDFNKTFWNQMQKIFADMQGFTFK from human MUC3A/B were used as the immunogen for the MUC3 antibody.
Format: Purified

Handling & Safety

Storage: -20°C
Shipping: -20°C (International: -20°C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-MUC3"
Write a review
or to review a product.
Viewed