Anti-MUC2 / Mucin 2

Anti-MUC2 / Mucin 2
Item number Size Datasheet Manual SDS Delivery time Quantity Price
NSJ-RQ4080 100 µg - -

3 - 10 business days*

790.00€
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Mucin 2, also known as MUC2, is a protein... more
Product information "Anti-MUC2 / Mucin 2"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Mucin 2, also known as MUC2, is a protein that in humans is encoded by the MUC2 gene. This gene encodes a member of the mucin protein family. It is mapped to 11p15.5. Mucin 2 is particularly prominent in the gut where it is secreted from goblet cells in the epithelial lining into the lumen of the large intestine. There, mucin 2, along with small amounts of related-mucin proteins, polymerizes into a gel of which 80% by weight is oligosaccharide side-chains that are added as post-translational modifications to the mucin proteins. This gel provides an insoluble mucous barrier that serves to protect the intestinal epithelium. The primary function of the MUC2 gene product is to provide a protective barrier between the epithelial surfaces and the gut lumen. There is decreased expression of MUC2 in colonic cancer and defective polymerization of secreted mucin in ulcerative colitis. Protein function: Coats the epithelia of the intestines, airways, and other mucus membrane-containing organs. Thought to provide a protective, lubricating barrier against particles and infectious agents at mucosal surfaces. Major constituent of both the inner and outer mucus layers of the colon and may play a role in excluding bacteria from the inner mucus layer. [The UniProt Consortium]
Keywords: Anti-MUC2, Anti-SMUC, Anti-MUC-2, Anti-Mucin-2, Anti-Intestinal mucin-2, MUC2 Antibody / Mucin 2
Supplier: NSJ Bioreagents
Supplier-Nr: RQ4080

Properties

Application: IHC (paraffin), IF
Antibody Type: Polyclonal
Conjugate: No
Host: Rabbit
Species reactivity: human, mouse, rat
Immunogen: Amino acids DDFKTASGLVEATGAGFANTWKAQSTCHDKLDWLDD from the human protein
Format: Glycobiology

Database Information

UniProt ID : Q02817 | Matching products

Handling & Safety

Storage: +4°C
Shipping: +4°C (International: +4°C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-MUC2 / Mucin 2"
Write a review
or to review a product.
Viewed