Anti-MST1 (Hepatocyte growth factor-like protein)

Anti-MST1 (Hepatocyte growth factor-like protein)
Item number Size Datasheet Manual SDS Delivery time Quantity Price
NSJ-RQ4066 100 µg - -

3 - 10 business days*

790.00€
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Macrophage-stimulating protein (MSP), also... more
Product information "Anti-MST1 (Hepatocyte growth factor-like protein)"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Macrophage-stimulating protein (MSP), also known as HLP, HGFL, or HGFLP, is a protein that in humans is encoded by the MST1 gene. The protein encoded by this gene contains four kringle domains and a serine protease domain, similar to that found in hepatic growth factor. Despite the presence of the serine protease domain, the encoded protein may not have any proteolytic activity. The receptor for this protein is RON tyrosine kinase, which upon activation stimulates ciliary motility of ciliated epithelial lung cells. This protein is secreted and cleaved to form an alpha chain and a beta chain bridged by disulfide bonds.
Keywords: Anti-MST1, Anti-D3F15S2, MST1 Antibody (Hepatocyte growth factor-like protein)
Supplier: NSJ Bioreagents
Supplier-Nr: RQ4066

Properties

Application: WB
Antibody Type: Polyclonal
Conjugate: No
Host: Rabbit
Species reactivity: human, mouse, rat
Immunogen: Amino acids QRSPLNDFQVLRGTELQHLLHAVVPGPWQEDVADAEE from the human protein were used as the immunogen for the MST1 antibody.
Format: Purified

Handling & Safety

Storage: +4°C
Shipping: +4°C (International: +4°C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-MST1 (Hepatocyte growth factor-like protein)"
Write a review
or to review a product.
Viewed