Anti-MRP2 / ABCC2

Item number Size Datasheet Manual SDS Delivery time Quantity Price
NSJ-RQ4941 100 µg - -

3 - 10 business days*

790.00€
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Multidrug resistance-associated protein 2... more
Product information "Anti-MRP2 / ABCC2"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Multidrug resistance-associated protein 2 (MRP2), also called canalicular multispecific organic anion transporter 1 (cMOAT) or ATP-binding cassette sub-family C member 2 (ABCC2), is a protein that in humans is encoded by the ABCC2 gene. The protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the MRP subfamily which is involved in multi-drug resistance. This protein is expressed in the canalicular (apical) part of the hepatocyte and functions in biliary transport. Substrates include anticancer drugs such as vinblastine, therefore, this protein appears to contribute to drug resistance in mammalian cells. Several different mutations in this gene have been observed in patients with Dubin-Johnson syndrome (DJS), an autosomal recessive disorder characterized by conjugated hyperbilirubinemia. Protein function: ATP-dependent transporter of the ATP-binding cassette (ABC) family that binds and hydrolyzes ATP to enable active transport of various substrates including many drugs, toxicants and endogenous compound across cell membranes. Transports a wide variety of conjugated organic anions such as sulfate-, glucuronide- and glutathione (GSH)- conjugates of endo- and xenobiotics substrates (PubMed:10220572, PubMed:10421658, PubMed:11500505, PubMed:16332456). Mediates hepatobiliary excretion of mono- and bis-glucuronidated bilirubin molecules and therefore play an important role in bilirubin detoxification (PubMed:10421658). Mediates also hepatobiliary excretion of others glucuronide conjugates such as 17beta-estradiol 17- glucosiduronic acid and leukotriene C4 (PubMed:11500505). Transports sulfated bile salt such as taurolithocholate sulfate (PubMed:16332456). Transports various anticancer drugs, such as anthracycline, vinca alkaloid and methotrexate and HIV-drugs such as protease inhibitors (PubMed:10220572, PubMed:11500505, PubMed:12441801). Confers resistance to several anti-cancer drugs including cisplatin, doxorubicin, epirubicin, methotrexate, etoposide and vincristine (PubMed:10220572, PubMed:11500505). [The UniProt Consortium]
Keywords: Anti-CMOAT, Anti-Canalicular multidrug resistance protein, Anti-Multidrug resistance-associated protein 2, Anti-ATP-binding cassette sub-family C member 2, Anti-Canalicular multispecific organic anion transporter 1, MRP2 Antibody / ABCC2
Supplier: NSJ Bioreagents
Supplier-Nr: RQ4941

Properties

Application: WB, IHC (paraffin)
Antibody Type: Polyclonal
Conjugate: No
Host: Rabbit
Species reactivity: human
Immunogen: Amino acids AIRHDCNFDKAMQFSEASFTWEHDSEATVRDVNLD from the human protein
Format: Purified

Handling & Safety

Storage: +4°C
Shipping: +4°C (International: +4°C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-MRP2 / ABCC2"
Write a review
or to review a product.
Anti-MRP2 Anti-MRP2
From 89.00€ *
Anti-ABCC2 Anti-ABCC2
From 89.00€ *
Anti-MRP2 Anti-MRP2
658.00€ *
Anti-ABCC2 Anti-ABCC2
From 165.00€ *
Viewed