Cookie preferences
This website uses cookies, which are necessary for the technical operation of the website and are always set. Other cookies, which increase the comfort when using this website, are used for direct advertising or to facilitate interaction with other websites and social networks, are only set with your consent.
Configuration
Technically required
These cookies are necessary for the basic functions of the shop.
"Allow all cookies" cookie
"Decline all cookies" cookie
CSRF token
Cookie preferences
Currency change
Customer-specific caching
FACT-Finder tracking
Individual prices
Selected shop
Session
Comfort functions
These cookies are used to make the shopping experience even more appealing, for example for the recognition of the visitor.
Note
Show the facebook fanpage in the right blod sidebar
Statistics & Tracking
Affiliate program
Conversion and usertracking via Google Tag Manager
Track device being used
| Item number | Size | Datasheet | Manual | SDS | Delivery time | Quantity | Price |
|---|---|---|---|---|---|---|---|
| NSJ-R31680 | 100 µg | - | - |
3 - 10 business days* |
790.00€
|
If you have any questions, please use our Contact Form.
You can also order by e-mail: info@biomol.com
Larger quantity required? Request bulk
You can also order by e-mail: info@biomol.com
Larger quantity required? Request bulk
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Stromelysin-1, also known as Matrix... more
Product information "Anti-MMP3"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Stromelysin-1, also known as Matrix metalloproteinase-3 (MMP-3), is an enzyme that in humans is encoded by the MMP3 gene. It is mapped to 11q22.2. Proteins of the matrix metalloproteinase (MMP) family are involved in the breakdown of extracellular matrix and during tissue remodeling in normal physiological processes, such as embryonic development and reproduction, as well as in disease processes, such as arthritis, and tumour metastasis. The MMP3 enzyme degrades collagen types II, III, IV, IX, and X, proteoglycans, fibronectin, laminin, and elastin. In addition, it can also activate other MMPs such as MMP1, MMP7, and MMP9, rendering MMP3 crucial in connective tissue remodeling. The enzyme is thought to be involved in wound repair, progression of atherosclerosis, and tumor initiation. Protein function: Can degrade fibronectin, laminin, gelatins of type I, III, IV, and V, collagens III, IV, X, and IX, and cartilage proteoglycans. Activates procollagenase. [The UniProt Consortium]
| Keywords: | Anti-SL-1, Anti-MMP3, Anti-MMP-3, Anti-STMY1, Anti-Transin-1, EC=3.4.24.17, Anti-Stromelysin-1, Anti-Matrix metalloproteinase-3, MMP3 Antibody |
| Supplier: | NSJ Bioreagents |
| Supplier-Nr: | R31680 |
Properties
| Application: | WB |
| Antibody Type: | Polyclonal |
| Conjugate: | No |
| Host: | Rabbit |
| Species reactivity: | human |
| Immunogen: | An amino acid sequence from the C-terminal of human MMP3 (RFDEKRNSMEPGFPKQIAEDFPGIDSKIDA) was used as the immunogen for this MMP3 antibody. |
| Format: | Purified |
Database Information
| KEGG ID : | K01394 | Matching products |
| UniProt ID : | P08254 | Matching products |
| Gene ID : | GeneID 4314 | Matching products |
Handling & Safety
| Storage: | +4°C |
| Shipping: | +4°C (International: +4°C) |
Caution
Our products are for laboratory research use only: Not for administration to humans!
Our products are for laboratory research use only: Not for administration to humans!
Information about the product reference will follow.
more
You will get a certificate here
Viewed