Anti-MMP17 / MT4-MMP

Item number	Size	Datasheet	Manual	SDS	Delivery time	Quantity	Price
ARG40422.50	50 µl		-	-	10 - 15 business days*		584.00€

If you have any questions, please use our Contact Form.
You can also order by e-mail: info@biomol.com
Larger quantity required? Request bulk

Protein function: Endopeptidase that degrades various components of the extracellular matrix,... more

Close menu

Product information "Anti-MMP17 / MT4-MMP"

Protein function: Endopeptidase that degrades various components of the extracellular matrix, such as fibrin. May be involved in the activation of membrane-bound precursors of growth factors or inflammatory mediators, such as tumor necrosis factor-alpha. May also be involved in tumoral process. Cleaves pro-TNF-alpha at the '74-Ala-, -Gln-75' site. Not obvious if able to proteolytically activate progelatinase A. Does not hydrolyze collagen types I, II, III, IV and V, gelatin, fibronectin, laminin, decorin nor alpha1- antitrypsin. [The UniProt Consortium]

Keywords:	Anti-MMP17, Anti-MTMMP4, Anti-MT4MMP, Anti-MMP-17, Anti-MT4-MMP, Anti-MT-MMP 4, EC=3.4.24.-, Anti-Matrix metalloproteinase-17, Anti-Membrane-type-4 matrix metalloproteinase, Anti-Membrane-type matrix metalloproteinase 4
Supplier:	Arigo Biolaboratories
Supplier-Nr:	ARG40422

Properties

Application:	WB
Antibody Type:	Polyclonal
Conjugate:	No
Host:	Rabbit
Species reactivity:	human (Expected: cow, horse)
Immunogen:	Synthetic peptide from Human MMP17 / MT4-MMP. (located within the following region: YPQSTARDWLVCGDSQADGSVAAGVDAAEGPRAPPGQHDQSRSEDGYEVC)
Format:	Affinity Purified