Anti-Mmp12

Anti-Mmp12
Item number Size Datasheet Manual SDS Delivery time Quantity Price
NSJ-R32074 100 µg - -

3 - 10 business days*

772.00€
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Matrix metalloproteinase-12 (MMP12), also... more
Product information "Anti-Mmp12"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Matrix metalloproteinase-12 (MMP12), also known as MME or ME, is an enzyme that in humans is encoded by the MMP12 gene. The gene is part of a cluster of MMP genes which localize to chromosome 11q22.2. It is thought that the protein encoded by this gene is cleaved at both ends to yield the active enzyme, but this processing has not been fully described. The enzyme degrades soluble and insoluble elastin. It may play a role in aneurysm formation and studies in mice suggest a role in the development of emphysema. This gene may involved in tissue injury and remodeling. Protein function: May be involved in tissue injury and remodeling. Has significant elastolytic activity. Can accept large and small amino acids at the P1' site, but has a preference for leucine. Aromatic or hydrophobic residues are preferred at the P1 site, with small hydrophobic residues (preferably alanine) occupying P3. [The UniProt Consortium]
Keywords: Anti-MME, Anti-Mme, Anti-Mmp12, Anti-MMP-12, EC=3.4.24.65, Anti-Macrophage metalloelastase, Anti-Matrix metalloproteinase-12, Mmp12 Antibody
Supplier: NSJ Bioreagents
Supplier-Nr: R32074

Properties

Application: WB, ELISA
Antibody Type: Polyclonal
Conjugate: No
Host: Rabbit
Species reactivity: mouse
Immunogen: Amino acids KIDAVLYFKRHYYIFQGAYQLEYDPLFRRVTKTLK of mouse Mmp-12 were used as the immunogen for the Mmp-12 antibody.
Format: Purified

Handling & Safety

Storage: -20°C
Shipping: -20°C (International: -20°C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-Mmp12"
Write a review
or to review a product.
Viewed