Anti-MLX / Max-like protein X

Item number Size Datasheet Manual SDS Delivery time Quantity Price
NSJ-RQ6889 100 µg - -

3 - 10 business days*

790.00€
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Max-like protein X is a protein that in... more
Product information "Anti-MLX / Max-like protein X"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Max-like protein X is a protein that in humans is encoded by the MLX gene. The product of this gene belongs to the family of basic helix-loop-helix leucine zipper (bHLH-Zip) transcription factors. These factors form heterodimers with Mad proteins and play a role in proliferation, determination and differentiation. This gene product may act to diversify Mad family function by its restricted association with a subset of the Mad family of transcriptional repressors, namely, Mad1 and Mad4. Alternatively spliced transcript variants encoding different isoforms have been identified for this gene. Protein function: Transcription regulator. Forms a sequence-specific DNA- binding protein complex with MAD1, MAD4, MNT, WBSCR14 and MLXIP which recognizes the core sequence 5'-CACGTG-3'. The TCFL4-MAD1, TCFL4-MAD4, TCFL4-WBSCR14 complexes are transcriptional repressors. Plays a role in transcriptional activation of glycolytic target genes. Involved in glucose-responsive gene regulation. [The UniProt Consortium]
Keywords: Anti-MLX, Anti-bHLHd13, Anti-BHLHD13, Anti-Protein BigMax, Anti-Max-like protein X, Anti-Max-like bHLHZip protein, Anti-Transcription factor-like protein 4, Anti-Class D basic helix-loop-helix protein 13, MLX Antibody / Max-like protein X
Supplier: NSJ Bioreagents
Supplier-Nr: RQ6889

Properties

Application: WB, FC
Antibody Type: Polyclonal
Conjugate: No
Host: Rabbit
Species reactivity: human, mouse, monkey
Immunogen: Amino acids FQELSACVFSWIEEHCKPQTLREIVIGVLHQLKNQLY from the human protein
Format: Gene Regulation

Handling & Safety

Storage: +4°C
Shipping: +4°C (International: +4°C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-MLX / Max-like protein X"
Write a review
or to review a product.
Viewed