Anti-MICA

Anti-MICA
Item number Size Datasheet Manual SDS Delivery time Quantity Price
NSJ-R32255 100 µg - -

3 - 10 business days*

790.00€
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. This gene encodes the highly polymorphic... more
Product information "Anti-MICA"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. This gene encodes the highly polymorphic major histocompatability complex class I chain-related protein A. The protein product is expressed on the cell surface, although unlike canonical class I molecules it does not seem to associate with beta-2-microglobulin. It is a ligand for the NKG2-D type II integral membrane protein receptor. And the protein functions as a stress-induced antigen that is broadly recognized by intestinal epithelial gamma delta T cells. Variations in this gene have been associated with susceptibility to psoriasis 1 and psoriatic arthritis, and the shedding of MICA-related antibodies and ligands is involved in the progression from monoclonal gammopathy of undetermined significance to multiple myeloma. Alternative splicing of this gene results in multiple transcript variants. Protein function: Seems to have no role in antigen presentation. Acts as a stress-induced self-antigen that is recognized by gamma delta T-cells. Ligand for the KLRK1/NKG2D receptor. Binding to KLRK1 leads to cell lysis. [The UniProt Consortium]
Keywords: Anti-MIC-A, Anti-MHC class I polypeptide-related sequence A, MICA Antibody
Supplier: NSJ Bioreagents
Supplier-Nr: R32255

Properties

Application: WB
Antibody Type: Polyclonal
Conjugate: No
Host: Rabbit
Species reactivity: human
Immunogen: Amino acids QSHWQTFHVSAVAAAAKFVEIIFYVRCCKKK of human MICA
Format: Immune Reaction

Handling & Safety

Storage: +4°C
Shipping: +4°C (International: +4°C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-MICA"
Write a review
or to review a product.
Viewed