Anti-MGST1

Anti-MGST1
Item number Size Datasheet Manual SDS Delivery time Quantity Price
NSJ-R31937 100 µg - -

3 - 10 business days*

790.00€
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Microsomal glutathione S-transferase 1 is... more
Product information "Anti-MGST1"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Microsomal glutathione S-transferase 1 is an enzyme that in humans is encoded by the MGST1 gene. The MAPEG (Membrane Associated Proteins in Eicosanoid and Glutathione metabolism) family consists of six human proteins, two of which are involved in the production of leukotrienes and prostaglandin E, important mediators of inflammation. Other family members, demonstrating glutathione S-transferase and peroxidase activities, are involved in cellular defense against toxic, carcinogenic, and pharmacologically active electrophilic compounds. This gene encodes a protein that catalyzes the conjugation of glutathione to electrophiles and the reduction of lipid hydroperoxides. This protein is localized to the endoplasmic reticulum and outer mitochondrial membrane where it is thought to protect these membranes from oxidative stress. Several transcript variants, some non-protein coding and some protein coding, have been found for this gene. Protein function: Conjugation of reduced glutathione to a wide number of exogenous and endogenous hydrophobic electrophiles. [The UniProt Consortium]
Keywords: Anti-MGST1, Anti-GST12, Anti-Microsomal GST-I, Anti-Microsomal GST-1, Anti-Microsomal glutathione S-transferase 1, MGST1 Antibody
Supplier: NSJ Bioreagents
Supplier-Nr: R31937

Properties

Application: WB, IHC (paraffin)
Antibody Type: Polyclonal
Conjugate: No
Host: Rabbit
Species reactivity: human, mouse, rat
Immunogen: Amino acids KVFANPEDCVAFGKGENAKKYLRTDDRVERVRRA of human MGST1
Format: Purified

Handling & Safety

Storage: +4°C
Shipping: +4°C (International: -20°C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-MGST1"
Write a review
or to review a product.
Viewed