Anti-MGST1

Item number	Size	Datasheet	Manual	SDS	Delivery time	Quantity	Price
ARG59037.50	50 µg		-	-	6 - 14 business days*		551.00€

If you have any questions, please use our Contact Form.
You can also order by e-mail: info@biomol.com
Larger quantity required? Request bulk

Protein function: Conjugation of reduced glutathione to a wide number of exogenous and endogenous... more

Close menu

Product information "Anti-MGST1"

Protein function: Conjugation of reduced glutathione to a wide number of exogenous and endogenous hydrophobic electrophiles. Has a wide substrate specificity. [The UniProt Consortium]

Keywords:	Anti-GST12, Anti-MGST1, EC=2.5.1.18, Anti-Microsomal GST-1, Anti-Microsomal GST-I, Anti-Microsomal glutathione S-transferase 1
Supplier:	Arigo Biolaboratories
Supplier-Nr:	ARG59037

Properties

Application:	WB
Antibody Type:	Polyclonal
Conjugate:	No
Host:	Rabbit
Species reactivity:	human, mouse, rat
Immunogen:	Synthetic peptide corresponding to aa. 42-75 of Human MGST1 (KVFANPEDCVAFGKGENAKKYLRTDDRVERVRRA)
MW:	18 kD
Format:	Antigen Affinity Purified