Anti-MEGF6

Anti-MEGF6
Item number Size Datasheet Manual SDS Delivery time Quantity Price
ARG59148.50 50 µl - -

10 - 15 business days*

584.00€
 
Product information "Anti-MEGF6"
Keywords: Anti-Megf6, Anti-Egfl3, Anti-EGF-like protein 3, Anti-Multiple EGF-like domains protein 6, Anti-Epidermal growth factor-like protein 3, Anti-Multiple epidermal growth factor-like domains protein 6
Supplier: Arigo Biolaboratories
Supplier-Nr: ARG59148

Properties

Application: WB
Antibody Type: Polyclonal
Conjugate: No
Host: Rabbit
Species reactivity: rat
Immunogen: Synthetic peptide around the middle region of Rat MEGF6. (within the following region: RRGCTSLEESVVDLDGRLPFVRPLPHIAVLRDELPRLFQDDYGAEEEAAA)
MW: 165 kD
Format: Affinity Purified

Handling & Safety

Storage: -20°C
Shipping: +4°C (International: °C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-MEGF6"
Write a review
or to review a product.
Viewed