Anti-MEFV / Pyrin

Anti-MEFV / Pyrin
Item number Size Datasheet Manual SDS Delivery time Quantity Price
ARG41730.50 50 µg - -

6 - 14 business days*

551.00€
 
Protein function: Involved in the regulation of innate immunity and the inflammatory response in... more
Product information "Anti-MEFV / Pyrin"
Protein function: Involved in the regulation of innate immunity and the inflammatory response in response to IFNG/IFN-gamma. Organizes autophagic machinery by serving as a platform for the assembly of ULK1, Beclin 1/BECN1, ATG16L1, and ATG8 family members and recognizes specific autophagy targets, thus coordinating target recognition with assembly of the autophagic apparatus and initiation of autophagy. Acts as an autophagy receptor for the degradation of several inflammasome components, including CASP1, NLRP1 and NLRP3, hence preventing excessive IL1B- and IL18- mediated inflammation (PubMed:16785446, PubMed:17431422, PubMed:26347139). However, it may also have a positive effect in the inflammatory pathway. In different experimental systems, it has been shown to activate IL1B production (PubMed:16037825). It has also been shown to be required for PSTPIP1-induced PYCARD oligomerization and for formation of inflammasomes. Recruits PSTPIP1 to inflammasomes, and is required for PSTPIP1 oligomerization (PubMed:10807793, PubMed:11468188, PubMed:17964261, PubMed:18577712, PubMed:19109554, PubMed:19584923). [The UniProt Consortium]
Keywords: Anti-MEF, Anti-MEFV, Anti-Pyrin, Anti-Marenostrin
Supplier: Arigo Biolaboratories
Supplier-Nr: ARG41730

Properties

Application: WB
Antibody Type: Polyclonal
Conjugate: No
Host: Rabbit
Species reactivity: human, rat
Immunogen: Synthetic peptide corresponding to aa. 5-39 of Human MEFV / Pyrin. (PSDHLLSTLEELVPYDFEKFKFKLQNTSVQKEHSR)
MW: 86 kD
Format: Antigen Affinity Purified

Handling & Safety

Storage: -20°C
Shipping: +4°C (International: °C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-MEFV / Pyrin"
Write a review
or to review a product.
Viewed