Anti-MDM4 / MDMX

Anti-MDM4 / MDMX
Item number Size Datasheet Manual SDS Delivery time Quantity Price
NSJ-R31805 100 µg - -

3 - 10 business days*

772.00€
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Protein Mdm4 is a protein that in humans... more
Product information "Anti-MDM4 / MDMX"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Protein Mdm4 is a protein that in humans is encoded by the MDM4 gene. This gene encodes a nuclear protein that contains a p53 binding domain at the N-terminus and a RING finger domain at the C-terminus, and shows structural similarity to p53-binding protein MDM2. Both proteins bind the p53 tumor suppressor protein and inhibit its activity, and have been shown to be overexpressed in a variety of human cancers. However, unlike MDM2 which degrades p53, this protein inhibits p53 by binding its transcriptional activation domain. This protein also interacts with MDM2 protein via the RING finger domain, and inhibits the latter's degradation. So this protein can reverse MDM2-targeted degradation of p53, while maintaining suppression of p53 transactivation and apoptotic functions. Alternatively spliced transcript variants encoding different isoforms have been noted for this gene. Protein function: Inhibits p53/TP53- and TP73/p73-mediated cell cycle arrest and apoptosis by binding its transcriptional activation domain. Inhibits degradation of MDM2. Can reverse MDM2-targeted degradation of TP53 while maintaining suppression of TP53 transactivation and apoptotic functions. [The UniProt Consortium]
Keywords: Anti-MDMX, Anti-MDM4, Anti-Protein Mdmx, Anti-Protein Mdm4, Anti-Double minute 4 protein, Anti-p53-binding protein Mdm4, Anti-Mdm2-like p53-binding protein, MDM4 Antibody / MDMX
Supplier: NSJ Bioreagents
Supplier-Nr: R31805

Properties

Application: WB, IHC (paraffin)
Antibody Type: Polyclonal
Conjugate: No
Host: Rabbit
Species reactivity: human, mouse
Immunogen: Amino acids KILHAAGAQGEMFTVKEVMHYLGQYIMVKQLYDQQEQH of human MDM4 were used as the immunogen for the MDM4 antibody.
Format: Purified

Handling & Safety

Storage: -20°C
Shipping: -20°C (International: -20°C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-MDM4 / MDMX"
Write a review
or to review a product.
Viewed