Anti-MDM4 / MDMX

Item number Size Datasheet Manual SDS Delivery time Quantity Price
ARG59046.50 50 µg - -

6 - 14 business days*

551.00€
 
Protein function: Inhibits p53/TP53- and TP73/p73-mediated cell cycle arrest and apoptosis by... more
Product information "Anti-MDM4 / MDMX"
Protein function: Inhibits p53/TP53- and TP73/p73-mediated cell cycle arrest and apoptosis by binding its transcriptional activation domain. Inhibits degradation of MDM2. Can reverse MDM2-targeted degradation of TP53 while maintaining suppression of TP53 transactivation and apoptotic functions. [The UniProt Consortium]
Keywords: Anti-MDMX, Anti-MDM4, Anti-Protein Mdm4, Anti-Protein Mdmx, Anti-Double minute 4 protein, Anti-p53-binding protein Mdm4, Anti-Mdm2-like p53-binding protein
Supplier: Arigo Biolaboratories
Supplier-Nr: ARG59046

Properties

Application: IHC (paraffin), WB
Antibody Type: Polyclonal
Conjugate: No
Host: Rabbit
Species reactivity: human, mouse (Expected: bovine, horse, monkey, rabbit)
Immunogen: Synthetic peptide corresponding to aa. 35-72 of Human MDMX (KILHAAGAQGEMFTVKEVMHYLGQYIMVKQLYDQQEQH)
MW: 55 kD
Format: Antigen Affinity Purified

Handling & Safety

Storage: -20°C
Shipping: +4°C (International: °C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-MDM4 / MDMX"
Write a review
or to review a product.
Viewed