Anti-MCOLN1 / TRPML1

Anti-MCOLN1 / TRPML1
Item number Size Datasheet Manual SDS Delivery time Quantity Price
ARG41330.50 50 µl - -

6 - 14 business days*

584.00€
 
Protein function: Nonselective cation channel probably playing a role in the regulation of... more
Product information "Anti-MCOLN1 / TRPML1"
Protein function: Nonselective cation channel probably playing a role in the regulation of membrane trafficking events and of metal homeostasis. Proposed to play a major role in Ca(2+) release from late endosome and lysosome vesicles to the cytoplasm, which is important for many lysosome-dependent cellular events, including the fusion and trafficking of these organelles, exocytosis and autophagy (PubMed:11013137, PubMed:12459486, PubMed:15336987, PubMed:14749347, PubMed:29019983). Required for efficient uptake of large particles in macrophages in which Ca(2+) release from the lysosomes triggers lysosomal exocytosis. May also play a role in phagosome-lysosome fusion. Involved in lactosylceramide trafficking indicative for a role in the regulation of late endocytic membrane fusion/fission events (PubMed:16978393). By mediating lysosomal Ca(2+) release is involved in regulation of mTORC1 signaling and in mTOR/TFEB- dependent lysosomal adaptation to environmental cues such as nutrient levels (PubMed:27787197, PubMed:25733853). Seems to act as lysosomal active oxygen species (ROS) sensor involved in ROS- induced TFEB activation and autophagy (PubMed:27357649). Functions as a Fe(2+) permeable channel in late endosomes and lysosomes (PubMed:18794901). Proposed to play a role in zinc homeostasis probably implicating its association with TMEM163 (PubMed:25130899) In adaptive immunity, TRPML2 and TRPML1 may play redundant roles in the function of the specialized lysosomes of B cells. [The UniProt Consortium]
Keywords: Anti-ML4, Anti-ML1, Anti-MG-2, Anti-TRPML1, Anti-MCOLN1, Anti-MSTP080, Anti-Mucolipidin, Anti-Mucolipin-1, Anti-Transient receptor potential channel mucolipin 1
Supplier: Arigo Biolaboratories
Supplier-Nr: ARG41330

Properties

Application: WB
Antibody Type: Polyclonal
Conjugate: No
Host: Rabbit
Species reactivity: human (Expected: mouse, rat, cow, dog, guinea pig, horse, swine, rabbit)
Immunogen: Synthetic peptide around the N-terminal region of Human MCOLN1 / TRPML1. (within the following region: FRHLFLLGYSDGADDTFAAYTREQLYQAIFHAVDQYLALPDVSLGRYAYV)
MW: 65 kD
Format: Affinity Purified

Handling & Safety

Storage: -20°C
Shipping: +4°C (International: °C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-MCOLN1 / TRPML1"
Write a review
or to review a product.
Viewed