Anti-MC2 Receptor / ACTH Receptor

Item number	Size	Datasheet	Manual	SDS	Delivery time	Quantity	Price
NSJ-R32754	100 µg		-	-	7 - 12 business days*		790.00€

If you have any questions, please use our Contact Form.
You can also order by e-mail: info@biomol.com
Larger quantity required? Request bulk

0.5mg/ml if reconstituted with 0.2ml sterile DI water. Melanocortin-2 receptor (MC2R), also known... more

Close menu

Product information "Anti-MC2 Receptor / ACTH Receptor"

0.5mg/ml if reconstituted with 0.2ml sterile DI water. Melanocortin-2 receptor (MC2R), also known as ACTH receptor (ACTHR), is a member of the G protein-coupled receptor family. This gene is mapped to 18p11.2. MC2R is selectively activated by adrenocorticotropic hormone, whereas the other four melanocortin receptors recognize a variety of melanocortin ligands. Mutations in MC2R can result in familial glucocorticoid deficiency. Alternate transcript variants have been found for this gene.

Keywords:	Anti-MC2R, Anti-MC2-R, Anti-ACTHR, Anti-ACTH-R, Anti-ACTH receptor, Anti-Melanocortin receptor 2, Anti-Adrenocorticotropin receptor, Anti-Adrenocorticotropic hormone receptor, MC2 Receptor Antibody / ACTH Receptor
Supplier:	NSJ Bioreagents
Supplier-Nr:	R32754

Properties

Application:	WB, FC
Antibody Type:	Polyclonal
Conjugate:	No
Host:	Rabbit
Species reactivity:	human, mouse, rat
Immunogen:	Amino acids 268-297 (NAVIDPFIYAFRSPELRDAFKKMIFCSRYW) from the human protein
Format:	Purified