Anti-MAPRE2 (Microtubule-associated Protein RP/EB Family Member 2, APC-binding Protein EB2, End-bind

Anti-MAPRE2 (Microtubule-associated Protein RP/EB Family Member 2, APC-binding Protein EB2, End-bind
Item number Size Datasheet Manual SDS Delivery time Quantity Price
129422.100 100 µl - -

3 - 19 business days*

943.00€
 
May be involved in microtubule polymerization, and spindle function by stabilizing microtubules... more
Product information "Anti-MAPRE2 (Microtubule-associated Protein RP/EB Family Member 2, APC-binding Protein EB2, End-bind"
May be involved in microtubule polymerization, and spindle function by stabilizing microtubules and anchoring them at centrosomes. May play a role in cell migration. Applications: Suitable for use in Immunoprecipitation. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MPGPTQTLSPNGENNNDIIQDNNGTIIPFRKHTVRGERSYSWGMAVNVYSTSITQETMSRHDIIAWVNDIVSLNYTKVEQLCSGAAYCQFMDMLFPGCISLKKVKFQAKLEHEYIHNFKLLQASFKRMNVDKVIPVEKLVKGRFQDNLDFIQWFKKFYDANYDGKEYDPVEARQGQDAIPPPDPGEQIFNLPKKSHHANSPTAGAAKSSPAAKPGSTPSRPSSAKRASSSGSASKSDKDLETQVIQLNEQVHSLKLALEGVEKERDFYFGKLREIELLCQEHGQENDDLVQRLMDILYASEEHEGHTEEPEAEEQAHEQQPPQQEEY, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Supplier: United States Biological
Supplier-Nr: 129422

Properties

Application: IP
Antibody Type: Polyclonal
Conjugate: No
Host: Rabbit
Species reactivity: human
Format: Serum

Database Information

Handling & Safety

Storage: -20°C
Shipping: +4°C (International: °C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-MAPRE2 (Microtubule-associated Protein RP/EB Family Member 2, APC-binding Protein EB2, End-bind"
Write a review
or to review a product.
Viewed