Anti-MAK / Male germ cell-associated kinase (C-Terminal Region)

Anti-MAK / Male germ cell-associated kinase (C-Terminal Region)
Item number Size Datasheet Manual SDS Delivery time Quantity Price
NSJ-R32835 100 µg - -

3 - 10 business days*

790.00€
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Serine/threonine-protein kinase MAK (Male... more
Product information "Anti-MAK / Male germ cell-associated kinase (C-Terminal Region)"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Serine/threonine-protein kinase MAK (Male germ cell-associated kinase) is an enzyme that in humans is encoded by the MAK gene. The product of this gene is a serine/threonine protein kinase related to kinases involved in cell cycle regulation. Studies of the mouse and rat homologs have localized the kinase to the chromosomes during meiosis in spermatogenesis, specifically to the synaptonemal complex that exists while homologous chromosomes are paired. Mutations in this gene have been associated with ciliary defects resulting in retinitis pigmentosa 62. Protein function: Essential for the regulation of ciliary length and required for the long-term survival of photoreceptors. Phosphorylates FZR1 in a cell cycle-dependent manner. Plays a role in the transcriptional coactivation of AR. Could play an important function in spermatogenesis. May play a role in chromosomal stability in prostate cancer cells. [The UniProt Consortium]
Keywords: Anti-MAK, Anti-Male germ cell-associated kinase, Anti-Serine/threonine-protein kinase MAK, MAK Antibody / Male germ cell-associated kinase (C-Terminal Region)
Supplier: NSJ Bioreagents
Supplier-Nr: R32835

Properties

Application: WB
Antibody Type: Polyclonal
Conjugate: No
Host: Rabbit
Species reactivity: human
Immunogen: Amino acids 588-623 (RTYNPTAKNLNIVNRAQPIPSVHGRTDWVAKYGGHR) were used as the immunogen for the MAK antibody.
Format: Purified

Handling & Safety

Storage: +4°C
Shipping: +4°C (International: +4°C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-MAK / Male germ cell-associated kinase (C-Terminal Region)"
Write a review
or to review a product.
Viewed