Anti-MAK

Anti-MAK
Item number Size Datasheet Manual SDS Delivery time Quantity Price
ARG59008.50 50 µg - -

6 - 14 business days*

551.00€
 
Protein function: Essential for the regulation of ciliary length and required for the long-term... more
Product information "Anti-MAK"
Protein function: Essential for the regulation of ciliary length and required for the long-term survival of photoreceptors. Phosphorylates FZR1 in a cell cycle-dependent manner. Plays a role in the transcriptional coactivation of AR. Could play an important function in spermatogenesis. May play a role in chromosomal stability in prostate cancer cells. [The UniProt Consortium]
Keywords: Anti-MAK, Anti-Male germ cell-associated kinase, Anti-Serine/threonine-protein kinase MAK
Supplier: Arigo Biolaboratories
Supplier-Nr: ARG59008

Properties

Application: WB
Antibody Type: Polyclonal
Conjugate: No
Host: Rabbit
Species reactivity: human
Immunogen: Synthetic peptide corresponding to aa. 588-623 of Human MAK (RTYNPTAKNLNIVNRAQPIPSVHGRTDWVAKYGGHR)
MW: 71 kD
Format: Antigen Affinity Purified

Handling & Safety

Storage: -20°C
Shipping: +4°C (International: °C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-MAK"
Write a review
or to review a product.
Viewed